PRGDB00000030 (Bs2)

From PRG Wiki
Revision as of 22:30, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Bs2
Gene Type Reference_R-Genes,_manually_curated
GenBank 6456754 (AF202179)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Capsicum chacoense

Comment?

Capsicum chacoense disease resistance protein BS2 (BS2) mRNA, complete cds.

DNA Sequence

ATGGCTCATGCAAGTGTGGCTTCTCTTATGAGAACAATAGAATCTCTCTTGACATTCAATTCGCCGATGCAATCTCTATCCTGTGATCACAGAGAAGAACTTTGCGCTCTTCGTGAAAAAGTTAGTTCCCTGGAAGTATTTGTCAAGAACTTTGAGAAAAACAATGTTTTTGGGGAAATGACGGATTTTGAAGTAGAGGTAAGAGAAGTTGCAAGTGCTGCTGAATACACAATTCAACTGAGACTAACAGGAACTGTACTGGGAGAAAATAAAAGCCAGAAAAAAAAGGCGCGTCGAAGGTTTCGTCAAAGCCTGCAACAAGTAGCAGAGGACATGGATCATATCTGGAAAGAGTCGACAAAGATCCAAGATAAAGGAAAACAAGTATCAAAGGAATCATTGGTTCATGATTTTTCAAGTTCAACAAACGATATTTTGAAGGTTAAGAACAATATGGTTGGACGTGATGATCAAAGGAAACAGTTGTTAGAAGATCTGACTAGAAGCTACTCTGGGGAACCCAAAGTCATCCCGATTGTCGGGATGGGAGGCATAGGTAAAACAACCTTAGCAAAAGAAGTTTACAATGATGAATCAATTCTATGCCGTTTTGATGTTCATGCCTGGGCTACCATATCTCAACAGCACAACAAAAAGGAAATTTTGCTGGGCCTTCTGCATTCCACAATCAAAATGGATGACAGGGTTAAGATGATTGGTGAAGCAGAGCTAGCAGACATGTTACAGAAAAGTTTAAAGAGAAAGAGGTACTTAATTGTCTTGGATGATATCTGGAGTTGTGAAGTGTGGGATGGCGTGAGACGATGCTTTCCAACTGAAGACAATGCAGGGAGTCGAATACTGTTGACTACCCGTAATGATGAAGTAGCTTGTTATGCTGGTGTAGAGAATTTTTCTTTGCGGATGAGCTTCATGGATCAAGATGAGAGTTGGAGTCTTTTCAAAAGTGCAGCATTTTCAAGTGAAGCATTACCATATGAGTTCGAGACTGTTGGAAAGCAAATCGCAGATGAATGTCACGGGTTACCACTAACTATTGTCGTGGTTGCAGGGCTTCTCAAATCTAAAAGGACAATAGAAGATTGGAAAACTGTTGCTAAAGATGTCAAGTCATTCGTCACAAATGATCCTGATGAACGATGTTCACGTGTGCTTGGGTTGAGTTACGATCACTTGACAAGCGATCTAAAAACATGTCTTCTGCATTTCGGAATTTTTCCAGAAGACAGTGATATTCCAGTGAAGAATTTGATGAGATCATGGATGGCTGAGGGGTTCCTGAAGTTGGAAAATGATTTGGAAGGAGAGGTTGAGAAGTGTTTGCAAGAGCTTGTCGATAGATGTCTAGTCCTCGTCAGCAAGAGAAGTCGAGATGGAACAAAAATTAGATCATGTAAGGTTCATGATCTAATATATGACCTGTGCGTGAGAGAAGTTCAAAGGGAGAACATTTTTATCATGAACGACATTGTTCTTGACGTATCATATCCAGAATGTTCATATCTCTGTATGTATAAAATGCAGCCCTTTAAGCGCGTGACTGGTGATGAAATTAATTATTGTCCCTATGGTCTTTATAGGGCTCTTCTTACCCCTGTAAATCGTCAGTTGAGAGATCATGACAACAACAATCTTTTGAAACGAACCCATTCTGTTTTCTCTTTTCATCTTGAGCCTTTATATTATGTTCTCAAATCAGAGGTTGTTCATTTCAAATTACTCAAAGTCTTGGAGCTGAGACACAGACAGATTGATGGTTTCCCTCGAGAGATACTAAGCCTCATCTGGTTGAGGTACCTATCATTGTTCAGCTATGGGAATTTCGATGTACCTCCAGAAATTTGCAGGTTATGGAATCTGCAGACATTCATTGTTCAACGGTTTCGATCAGATATAATAATTTTTGCTGAGGAAATTTGGGAACTAATGCAATTAAGGCATCTTAAACTGCCCAGATTTTATTTGCCAGATTGCCCAAGTGGATCTGTTGACAAAGGAAGGCACTTGGATTTTTCAAACTTACAAACTATTTCTTACTTGTCTCCACGTTGTTGCACGAAGGAGGTTATTATGGGGATTCAGAATGTCAAAAAATTAGGAATCAGTGGAAATAAGGATGACTATAAAAGTTTTCGGGACTCTGGGCTTCCCAACAATCTTGTCTATCTGCAGCAACTTGAAATATTGAGTCTTATATCTGTTGATTATAGCCTTTTGCCAGTGATCATTTCAAGTGCAAAAGCTTTTCCAGCAACGCTCAAGAAGTTGAAGTTGGAAAGAACTTATCTAAGCTGGTCATACTTGGACATCATAGCTGAGTTGCCTAACCTTGAGGTGCTGAAGCTGATGGATGACGCTTGTTGTGGTGAAGAATGGCATCCAATTGTTATGGGATTTAATCGATTGAAGCTTTTGCTAATTAAATATAGTTTTCTCAAGTTCTGGAAAGCCACAAATGACAATTTTCCTGTCCTTGAGCGCCTCATGATTAGAAGTTGCAAAAATTTGAAAGAGATACCCATTGAGTTTGCAGATATACACACACTACAGCTGATTGAGTTAAGAGAGTGTCCTCCCAAACTTGGGGAATCTGCTGCACGAATTCAGAAAGAACAAGAAGACCTCGGAAACAACCCTGTGGATGTTCGTATCTCAAATCCATTGAAGGAGAGTGATTCTGATTCAGAAGAACATTAG


Protein sequences

Name Description Sequence
disease resistance protein BS2 disease resistance protein BS2 [Capsicum chacoense].

MAHASVASLMRTIESLLTFNSPMQSLSCDHREELCALREKVSSLEVFVKNFEKNNVFGEMTDFEVEVREVASAAEYTIQLRLTGTVLGENKSQKKKARRRFRQSLQQVAEDMDHIWKESTKIQDKGKQVSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGVENFSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLLKSKRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHFGIFPEDSDIPVKNLMRSWMAEGFLKLENDLEGEVEKCLQELVDRCLVLVSKRSRDGTKIRSCKVHDLIYDLCVREVQRENIFIMNDIVLDVSYPECSYLCMYKMQPFKRVTGDEINYCPYGLYRALLTPVNRQLRDHDNNNLLKRTHSVFSFHLEPLYYVLKSEVVHFKLLKVLELRHRQIDGFPREILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIVQRFRSDIIIFAEEIWELMQLRHLKLPRFYLPDCPSGSVDKGRHLDFSNLQTISYLSPRCCTKEVIMGIQNVKKLGISGNKDDYKSFRDSGLPNNLVYLQQLEILSLISVDYSLLPVIISSAKAFPATLKKLKLERTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLLLIKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGESAARIQKEQEDLGNNPVDVRISNPLKESDSDSEEH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF125
2-491 PTHR11017:SF125,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AHASVASLMRTIESLLTFNSPMQSLSCDHREELCALREKVSSLEVFVKNFEKNNVFGEMTDFEVEVREVASAAEYTIQLRLTGTVLGENKSQKKKARRRFRQSLQQVAEDMDHIWKESTKIQDKGKQVSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGVENFSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLLKSKRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHFGIFPEDSDIPVKNLMRSWMAEGFLKLENDLEGEVEKCLQELVDRCLVLVSKRSRDGTKIRSCKVHDLIYDLCVREVQRENI

HMMPanther: PTHR11017
2-491 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AHASVASLMRTIESLLTFNSPMQSLSCDHREELCALREKVSSLEVFVKNFEKNNVFGEMTDFEVEVREVASAAEYTIQLRLTGTVLGENKSQKKKARRRFRQSLQQVAEDMDHIWKESTKIQDKGKQVSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGVENFSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLLKSKRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHFGIFPEDSDIPVKNLMRSWMAEGFLKLENDLEGEVEKCLQELVDRCLVLVSKRSRDGTKIRSCKVHDLIYDLCVREVQRENI

superfamily: SSF52540
135-383 SSF52540

VHDFSSSTNDILKVKNNMVGRDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGVENFSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLLKSKRTIEDWKTVAKDVKSFVTND

Gene3D: G3DSA:3.40.50.300
155-292 G3DSA:3.40.50.300

RDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTR

HMMPfam: PF00931
IPR002182
156-438 NB-ARC,NBS
NB-ARC

DDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCEVWDGVRRCFPTEDNAGSRILLTTRNDEVACYAGVENFSLRMSFMDQDESWSLFKSAAFSSEALPYEFETVGKQIADECHGLPLTIVVVAGLLKSKRTIEDWKTVAKDVKSFVTNDPDERCSRVLGLSYDHLTSDLKTCLLHFGIFPEDSDIPVKNLMRSWMAEGFLKLEN

FPrintScan: PR00364
IPR000767
176-191 DISEASERSIST
Disease resistance protein

VIPIVGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

SLKRKRYLIVLDDIW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CHGLPLTIVVVAGLL

superfamily: SSF52058
473-864 SSF52058,LRR

KVHDLIYDLCVREVQRENIFIMNDIVLDVSYPECSYLCMYKMQPFKRVTGDEINYCPYGLYRALLTPVNRQLRDHDNNNLLKRTHSVFSFHLEPLYYVLKSEVVHFKLLKVLELRHRQIDGFPREILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIVQRFRSDIIIFAEEIWELMQLRHLKLPRFYLPDCPSGSVDKGRHLDFSNLQTISYLSPRCCTKEVIMGIQNVKKLGISGNKDDYKSFRDSGLPNNLVYLQQLEILSLISVDYSLLPVIISSAKAFPATLKKLKLERTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLLLIKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELREC

Gene3D: G3DSA:3.80.10.10
567-865 G3DSA:3.80.10.10

LYYVLKSEVVHFKLLKVLELRHRQIDGFPREILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIVQRFRSDIIIFAEEIWELMQLRHLKLPRFYLPDCPSGSVDKGRHLDFSNLQTISYLSPRCCTKEVIMGIQNVKKLGISGNKDDYKSFRDSGLPNNLVYLQQLEILSLISVDYSLLPVIISSAKAFPATLKKLKLERTYLSWSYLDIIAELPNLEVLKLMDDACCGEEWHPIVMGFNRLKLLLIKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECP

FPrintScan: PR00364
IPR000767
827-843 DISEASERSIST
Disease resistance protein

DNFPVLERLMIRSCKNL


Diseases

Disease Pathogen Avirulence gene
Bacterial Spot Xanthomonas campestris PRGAV00000029
Leaf Spot Xanthomonas campestris PRGAV00000029

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox