PRGDB00000033 (Cf-4)

From PRG Wiki
Revision as of 22:30, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cf-4
Gene Type Reference_R-Genes,_manually_curated
GenBank 2808679 (AJ002235)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 1
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Cf-4 resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTAGAATTCAAGAACATGTTTACCGTTAATCCTAATGCTTCTGATTATTGTTACGACAGAAGAACTCTTTCTTGGAACAAAAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAAACGACAGGACAAGTGATTGAGCTTGACCTCCGTTGCATCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATTTGTCTTATAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGCATTCAAGTTTTAGGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTATACGTTCTTCGTATTAGTCTAAATGAGCTTACTTTTGGTCCTCACAATTTTGAATTGCTTCTTAAGAACTTGACCCAATTAAAAGTGCTCGACCTTGAATCTATCAACATCTCTTCCACTATTCCTTTGAATTTCTCTTCTCATTTAACAAATCTATGGCTTCCATACACAGAGTTACGTGGGATATTGCCCGAAAGAGTTTTCCACCTTTCCGACTTAGAATTTCTCGATTTATCAAGCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATATCTCTATAATGTGAATATTGATGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATAAGTTGTACATGAGTCGTTCTAATCTGTCAGGGCCTATTCCTAAACCTCTATGGAATCTCACCAACATAGTGTTTTTGGACCTTAATAATAACCATCTTGAAGGACCAATTCCATCCAACGTAAGCGGACTACGTAACCTACAAATACTTTGGTTGTCATCAAACAACTTAAATGGGAGTATACCATCCTGGATATTCTCCCTTCCATCACTGATAGGGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTACCGTTACTCTAAAACAAAATAAGCTAAAAGGTCCTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAATTCCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCGCAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATTTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGGAAATTGATGAGAGTACAGGATTCCCAGAGTATATTTCTGATCCATATGATATTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTCGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGAAGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAAAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Cf-4 Cf-4 [Solanum habrochaites].

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-729 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPanther: PTHR24420
1-729 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

Gene3D: G3DSA:3.80.10.10
28-248 G3DSA:3.80.10.10

CPEDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCDETTGQVIELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTT

HMMPfam: PF08263
IPR013210
30-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLEFKNMFTVNPNASDYCYDRRTLSWNKSTSCCSWDGVHCD

superfamily: SSF52047
84-409 SSF52047,LRR

ELDLRCIQLQGKFHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSDLTHLDLSHSSFRGVIPSEISHLSKLYVLRISLNELTFGPHNFELLLKNLTQLKVLDLESINISSTIPLNFSSHLTNLWLPYTELRGILPERVFHLSDLEFLDLSSNPQLTVRFPTTKWNSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNIS

HMMPfam: PF13516
105-119 LRR_6,Leucine Rich repeat

LSNLKRLDLSYNDFT

ProfileScan: PS51450
IPR001611
107-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSYNDFTGSPISPKFG

HMMPfam: PF00560
IPR001611
133-154 LRR_1
Leucine-rich repeat

LTHLDLSHSSFRGVIPSEISHL

ProfileScan: PS51450
IPR001611
156-177 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYVLRISLNELTFGPHNFELL

ProfileScan: PS51450
IPR001611
183-204 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKVLDLESINISSTIPLNFSS

Gene3D: G3DSA:3.80.10.10
251-455 G3DSA:3.80.10.10

NSSASLMKLYLYNVNIDDRIPESFSHLTSLHKLYMSRSNLSGPIPKPLWNLTNIVFLDLNNNHLEGPIPSNVSGLRNLQILWLSSNNLNGSIPSWIFSLPSLIGLDLSNNTFSGKIQEFKSKTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNN

ProfileScan: PS51450
IPR001611
255-277 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLMKLYLYNVNIDDRIPESFSHL

ProfileScan: PS51450
IPR001611
303-326 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIVFLDLNNNHLEGPIPSNVSGLR

ProfileScan: PS51450
IPR001611
327-349 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILWLSSNNLNGSIPSWIFSL

HMMPfam: PF00560
IPR001611
327-348 LRR_1
Leucine-rich repeat

NLQILWLSSNNLNGSIPSWIFS

ProfileScan: PS51450
IPR001611
351-373 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIGLDLSNNTFSGKIQEFKSKT

superfamily: SSF52058
372-717 SSF52058,LRR

KTLSTVTLKQNKLKGPIPNSLLNQKNLQFLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF13516
396-418 LRR_6,Leucine Rich repeat

KNLQFLLLSHNNISGHISSAICN

ProfileScan: PS51450
IPR001611
397-420 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFLLLSHNNISGHISSAICNLK

ProfileScan: PS51450
IPR001611
446-467 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSHLDLSNNRLSGTINTTFSV

HMMPfam: PF13855
446-505 LRR_8,Leucine rich repeat

YLSHLDLSNNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
447-460 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNRLSGT

Gene3D: G3DSA:3.80.10.10
456-572 G3DSA:3.80.10.10

RLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKE

ProfileScan: PS51450
IPR001611
494-516 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTLLDLGNNMLNDTFPNWLGYL

ProfileScan: PS51450
IPR001611
518-539 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKILSLRSNKLHGPIKSSGNT

ProfileScan: PS51450
IPR001611
544-565 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQILDLSSNGFSGNLPERILG

HMMPfam: PF00560
IPR001611
545-567 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
616-726 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMPfam: PF13855
636-695 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
636-659 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRTLNLSHNVLEGHIPASFQNLS

ProfileScan: PS51450
IPR001611
660-683 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLESLDLSSNKISGEIPQQLASLT

FPrintScan: PR00019
682-695 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
684-706 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNHLVGCIPKGKQFD


Diseases

Disease Pathogen Avirulence gene
Leaf Mould Passalora fulva PRGAV00000033

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox