PRGDB00000042 (Mi1.2)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Mi1.2
Gene Type Reference_R-Genes,_manually_curated
GenBank 3449379 (AF039682)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 6
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum root-knot nematode resistance protein (Mi-1.2) mRNA, complete cds.

DNA Sequence

ATGGAAAAACGAAAAGATATTGAAGAAGCAAACAACTCATTGGTGTTATTTTCTGCTCTTAGCAAGGACATTGCCAATGTTCTAATTTTCCTAGAGAATGAGGAAAATCAAAAAGCTCTTGACAAAGATCAAGTTGAAAAGCTAAAATTGAAAATGGCATTTATTTGTACATATGTTCAGCTTTCTTATTCCGATTTTGAGCAGTTTGAAGATATAATGACTAGAAATAGACAAGAGGTTGAGAATCTGCTTCAATCACTTTTGGATGATGATGTCCTTACTAGCCTCACCAGTAATATGGATGACTGTATCAGCTTGTATCATCGTTCTTATAAATCAGATGCCATCATGATGGATGAGCAATTGGACTTCCTCCTCTTGAATCTGTATCATCTATCCAAGCATCACGCTGAAAAGATATTTCCTGGAGTGACTCAATATGAAGTTCTTCAGAATGTATGTGGCAACATAAGAGATTTCCATGGGTTGATACTGAATGGTTGCATTAAGCATGAGATGGTTGAGAATGTCTTACCTCTGTTTCAACTCATGGCTGAAAGAGTAGGACACTTCCTTTGGGAGGATCAGACTGATGAAGACTCTCGGCTCTCCGAGCTAGATGAGGATGAACACAATGATAGAGACTCTCGACTCTTCCAGCTAACACATCTACTCTTGAAGATTGTTCCAACTGAACTGGAGGTTATGCACATATGTTATACAAATTTGAAAGCTTCAACTTCAGCAGAAGTTGGACGCTTCATTAAGAAGCTCCTGGAAACCTCACCGGATATTCTCAGAGAATATATCATTCAACTACAAGAGCATATGTTAACTGTTATTCCCCCTAGCACTTTAGGGGCTCGAAACATTCATGTCATGATGGAATTCCTATTACTTATTCTTTCTGATATGCCCAAGGACTTTATTCATCATGACAAACTTTTTGATCTCTTGGCTCATGTTGGAACACTTACCAGGGAGGTATCGACTCTTGTACGTGACTTGGAAGAGAAATTAAGGAATAAAGAGGGTAATAACCAAACAAATTGTGCAACCCTAGACTTGCTGGAAAATATTGAACTCCTCAAGAAAGATCTCAAACATGTTTATCTGAAAGCCCCAAATTCATCTCAATGTTGCTTCCCCATGAGTGATGGACCACTCTTCATGCATCTTCTACACATGCACTTAAATGATTTGCTAGATTCTAATGCTTATTCAATTTCTTTGATAAAGGAAGAAATCGAGTTGGTGAGTCAAGAACTGGAATTCATAAGATCATTCTTTGGGGATGCTGCTGAGCAAGGATTGTATAAAGATATCTGGGCACGTGTTCTAGATGTGGCTTATGAGGCAAAAGATGTCATAGATTCAATTATTGTTCGAGATAATGGTCTCTTACATCTTATTTTCTCACTTCCCATTACCATAAAGAAGATCAAACTTATCAAAGAAGAGATCTCTGCTTTAGATGAGAACATTCCCAAGGACAGAGGTCTAATCGTTGTGAACTCTCCCAAGAAACCAGTTGAGAGAAAGTCATTGACAACTGATAAAATAATTGTAGGTTTTGAGGAGGAGACAAACTTGATACTTAGAAAGCTCACCAGTGGACCCGCAGATTTAGATGTCATTTCGATCACCGGTATGCCGGGTTCAGGTAAAACTACTTTGGCATACAAAGTATACAATGATAAGTCAGTTTCTAGACATTTTGACCTTCGTGCATGGTGCACGGTCGATCAAGGATATGACGACAAGAAGTTGTTGGATACAATTTTCAGTCAAGTTAGTGGCTCAGATTCAAATTTGAGTGAGAATATTGATGTTGCTGATAAATTGCGGAAACAACTGTTTGGAAAGAGGTATCTTATTGTCTTAGATGATGTGTGGGATACTACTACATTGGATGAGTTGACAAGACCTTTTCCTGAAGCTAAGAAAGGAAGTAGGATTATTTTGACAACTCGAGAAAAGGAAGTGGCTTTGCATGGAAAGCTGAACACTGATCCTCTTGACCTTCGATTGCTAAGACCAGATGAAAGTTGGGAACTTTTAGATAAAAGGACATTTGGTAATGAGAGTTGCCCTGATGAACTATTAGATGTCGGTAAAGAAATAGCCGAAAATTGTAAAGGGCTTCCTTTGGTGGCTGATCTGATTGCTGGAGTCATTGCTGGGAGGGAAAAGAAAAGGAGTGTGTGGCTTGAAGTTCAAAGTAGTTTGAGTTCTTTTATTTTGAACAGTGAAGTGGAAGTGATGAAAGTTATAGAATTAAGTTATGACCATTTACCACATCACCTCAAGCCATGCTTGCTTCACTTTGCAAGTTGGCCGAAGGACACTCCTTTGACAATCTATTTGTTTACTGTTTATTTGGGTGCTGAAGGATTTGTGGAAAAGACGGAGATGAAGGGTATAGAAGAAGTGGTGAAGATTTATATGGATGATTTAATTTCCAGTAGCTTGGTAATTTGTTTCAATGAGATAGGTGATATACTGAATTTCCAAATTCATGATCTTGTGCATGACTTTTGTTTGATAAAAGCAAGAAAGGAAAATTTGTTTGATCGGATAAGATCAAGTGCTCCATCAGATTTGTTGCCTCGTCAAATTACCATTGATTATGATGAGGAGGAGGAGCACTTTGGGCTTAATTTTGTCATGTTCGATTCAAATAAGAAAAGGCATTCTGGTAAACACCTCTATTCTTTGAGGATAAATGGAGACCAGCTGGATGACAGTGTTTCTGATGCATTTCACCTAAGACACTTGAGGCTTATTAGAGTGTTGGACCTGGAACCCTCTTTAATCATGGTGAATGATTCTTTGCTGAATGAAATATGCATGTTGAATCATTTGAGGTACTTAAGAATTCGGACACAAGTTAAATATCTGCCTTTCTCTTTCTCAAACCTCTGGAATCTAGAAAGTCTGTTTGTGTCTAACAAAGGATCAATCTTGGTACTATTACCGAGAATTTTGGATCTTGTAAAGTTGCGAGTGCTGTCCGTGGGTGCTTGTTCTTTCTTTGATATGGATGCAGATGAATCAATATTGATAGCAAAGGACACAAAGTTAGAGAACTTGAGAATATTAGGGGAACTGTTGATTTCCTATTCGAAAGATACAATGAATATTTTCAAAAGGTTTCCCAATCTTCAGGTGCTTCAGTTTGAACTCAAGGAGTCATGGGATTATTCAACAGAGCAACATTGGTTCCCGAAATTGGATTGCCTAACTGAACTAGAAACACTCTGTGTAGGTTTTAAAAGTTCAAACACAAACCACTGTGGGTCCTCTGTTGTGACAAATCGGCCGTGGGATTTTCACTTCCCTTCAAATTTGAAAGAACTGTTGTTGTATGACTTTCCTCTGACATCCGATTCACTATCAACAATAGCGAGACTGCCCAACCTTGAAAATTTGTCCCTTTATGATACAATCATCCAGGGAGAAGAATGGAACATGGGGGAGGAAGACACTTTTGAGAATCTCAAATTTTTGAACTTGCGTCTACTGACTCTTTCCAAGTGGGAGGTTGGAGAGGAATCCTTCCCCAATCTTGAGAAATTAAAACTGCAGGAATGTGGTAAGCTTGAGGAGATTCCACCTAGTTTTGGAGATATTTATTCATTGAAATTTATCAAAATTGTAAAGAGTCCTCAACTTGAAGATTCTGCTCTCAAGATTAAGAAATACGCTGAAGATATGAGAGGAGGGAACGATCTTCAGATCCTTGGCCAGAAGAATATCCCCTTATTTAAGTAG


Protein sequences

Name Description Sequence
root-knot nematode resistance protein root-knot nematode resistance protein [Lycopersicon esculentum].

MEKRKDIEEANNSLVLFSALSKDIANVLIFLENEENQKALDKDQVEKLKLKMAFICTYVQLSYSDFEQFEDIMTRNRQEVENLLQSLLDDDVLTSLTSNMDDCISLYHRSYKSDAIMMDEQLDFLLLNLYHLSKHHAEKIFPGVTQYEVLQNVCGNIRDFHGLILNGCIKHEMVENVLPLFQLMAERVGHFLWEDQTDEDSRLSELDEDEHNDRDSRLFQLTHLLLKIVPTELEVMHICYTNLKASTSAEVGRFIKKLLETSPDILREYIIQLQEHMLTVIPPSTLGARNIHVMMEFLLLILSDMPKDFIHHDKLFDLLAHVGTLTREVSTLVRDLEEKLRNKEGNNQTNCATLDLLENIELLKKDLKHVYLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLFTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEEEEHFGLNFVMFDSNKKRHSGKHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNLQVLQFELKESWDYSTEQHWFPKLDCLTELETLCVGFKSSNTNHCGSSVVTNRPWDFHFPSNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEEWNMGEEDTFENLKFLNLRLLTLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKIVKSPQLEDSALKIKKYAEDMRGGNDLQILGQKNIPLFK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
371-880 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLFTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEE

HMMPanther: PTHR11017:SF14
371-880 PTHR11017:SF14

YLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLFTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEE

superfamily: SSF52540
503-733 SSF52540

VVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKR

HMMPfam: PF00931
IPR002182
526-803 NB-ARC,NBS
NB-ARC

EEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLDKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLFTVYLGAEGFVEKT

Gene3D: G3DSA:3.40.50.300
529-553 G3DSA:3.40.50.300

TNLILRKLTSGPADLDVISITGMPG

FPrintScan: PR00364
IPR000767
545-560 DISEASERSIST
Disease resistance protein

VISITGMPGSGKTTLA

Gene3D: G3DSA:3.40.50.300
554-680 G3DSA:3.40.50.300

SGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRP

FPrintScan: PR00364
IPR000767
618-632 DISEASERSIST
Disease resistance protein

QLFGKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
712-726 DISEASERSIST
Disease resistance protein

CKGLPLVADLIAGVI

superfamily: SSF52058
838-1221 SSF52058,LRR

QIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEEEEHFGLNFVMFDSNKKRHSGKHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNLQVLQFELKESWDYSTEQHWFPKLDCLTELETLCVGFKSSNTNHCGSSVVTNRPWDFHFPSNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEEWNMGEEDTFENLKFLNLRLLTLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKIVK

Gene3D: G3DSA:3.80.10.10
901-1055 G3DSA:3.80.10.10

KHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNL

Gene3D: G3DSA:3.80.10.10
1115-1155 G3DSA:3.80.10.10

SNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEE

FPrintScan: PR00364
IPR000767
1185-1201 DISEASERSIST
Disease resistance protein

ESFPNLEKLKLQECGKL


Diseases

Disease Pathogen Avirulence gene
Root-knot nematode Meloidogyne, Paratrichodorus minor

List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox