PRGDB00000044 (N)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
N
Gene Type Reference_R-Genes,_manually_curated
GenBank 558886 (U15605)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Nicotiana glutinosa

Comment?

Nicotiana glutinosa virus resistance (N) gene, complete cds.

DNA Sequence

ATGGCATCTTCTTCTTCTTCTTCTAGATGGAGCTATGATGTTTTCTTAAGTTTTAGAGGCGAAGATACTCGAAAAACGTTTACAAGTCACTTATACGAAGTCTTGAATGATAAGGGAATAAAAACCTTTCAAGATGATAAAAGGCTAGAGTACGGCGCAACCATCCCAGGTGAACTCTGTAAAGCTATAGAAGAGTCTCAATTTGCCATTGTTGTTTTCTCAGAGAATTATGCAACATCAAGGTGGTGTTTGAATGAACTAGTGAAGATCATGGAATGCAAAACTCGATTTAAGCAAACTGTTATACCGATATTCTATGATGTGGATCCATCACATGTTCGGAACCAAAAGGAGAGCTTTGCAAAAGCCTTTGAAGAACATGAAACAAAGTATAAGGATGATGTTGAGGGAATACAAAGATGGAGGATTGCTTTAAATGAAGCGGCCAATCTCAAAGGCTCCTGTGATAATCGTGACAAGACTGATGCAGACTGTATTCGACAGATTGTTGACCAAATCTCATCCAAATTATGCAAGATTTCTTTATCTTATTTGCAAAACATTGTTGGAATAGATACTCATTTAGAGAAAATAGAATCCTTACTAGAGATAGGAATCAATGGTGTTCGGATTATGGGGATCTGGGGAATGGGGGGAGTCGGTAAAACAACAATAGCAAGAGCTATATTTGATACTCTTTTAGGAAGAATGGATAGTTCCTATCAATTTGATGGTGCTTGTTTCCTTAAGGATATTAAAGAAAACAAACGTGGAATGCATTCTTTGCAAAATGCCCTTCTCTCTGAACTTTTAAGGGAAAAAGCTAATTACAATAATGAGGAGGATGGAAAGCACCAAATGGCTAGTAGACTTCGTTCGAAGAAGGTCCTAATTGTGCTTGATGATATAGATAATAAAGATCATTATTTGGAGTATTTAGCAGGTGATCTTGATTGGTTTGGTAATGGTAGTAGAATTATTATAACAACTAGAGACAAGCATTTGATAGAGAAGAATGATATAATATATGAGGTGACTGCACTACCCGATCATGAATCCATTCAATTGTTCAAACAACATGCTTTCGGAAAAGAAGTTCCAAATGAGAATTTTGAGAAGCTTTCATTAGAGGTAGTAAATTATGCTAAAGGCCTTCCTTTAGCCCTCAAAGTGTGGGGTTCTTTGCTGCATAACCTACGATTAACTGAATGGAAAAGTGCTATAGAGCACATGAAAAATAACTCTTATTCTGGAATTATTGATAAGCTCAAAATAAGTTATGATGGATTAGAGCCCAAACAACAAGAGATGTTTTTAGATATAGCATGCTTCTTGCGAGGGGAAGAAAAAGATTACATCCTACAAATCCTTGAGAGTTGTCATATTGGAGCTGAATACGGGTTACGTATTTTAATTGACAAATCTCTTGTGTTCATCTCTGAATATAATCAGGTTCAAATGCATGACTTAATACAGGATATGGGTAAATATATAGTGAATTTTCAAAAAGATCCCGGAGAACGTAGCAGATTATGGCTCGCCAAGGAAGTCGAAGAAGTGATGAGCAACAACACAGGGACCATGGCAATGGAAGCAATTTGGGTTTCTTCTTATTCTAGTACTCTACGCTTTAGCAATCAGGCCGTGAAAAATATGAAAAGGCTTAGGGTATTTAACATGGGGAGGTCGTCGACACATTATGCCATCGATTATCTGCCCAACAACTTGCGTTGTTTTGTTTGCACTAACTATCCTTGGGAGTCATTTCCATCTACATTTGAACTCAAAATGCTTGTTCACCTCCAACTCCGACACAATTCTCTGCGTCATTTATGGACAGAAACAAAGCATTTGCCGTCTCTACGGAGGATAGATCTCAGCTGGTCTAAAAGATTGACGCGAACACCAGATTTCACGGGGATGCCAAATTTGGAGTATGTGAATTTGTATCAATGTAGTAATCTTGAAGAAGTTCACCATTCCCTGGGATGTTGCAGCAAAGTCATTGGTTTATATTTGAATGATTGTAAAAGCCTTAAGAGGTTTCCATGTGTTAACGTGGAATCTCTTGAATATCTGGGTCTAAGAAGTTGCGATAGTTTAGAGAAATTGCCAGAAATCTACGGGAGAATGAAGCCGGAGATACAGATTCACATGCAAGGCTCTGGGATAAGGGAACTACCATCATCTATTTTTCAGTACAAAACTCATGTTACCAAGCTATTGTTGTGGAATATGAAAAACCTTGTAGCTCTTCCAAGCAGCATATGTAGGTTGAAAAGTTTGGTTAGTCTGAGTGTGTCGGGTTGCTCAAAACTTGAAAGCTTGCCAGAAGAGATAGGGGATTTAGACAACTTACGGGTGTTTGATGCCAGTGATACTCTAATTTTACGACCTCCGTCTTCCATCATACGCTTGAACAAACTTATAATCTTGATGTTTCGAGGCTTCAAAGATGGAGTGCACTTTGAGTTCCCTCCTGTGGCTGAAGGATTACACTCATTGGAATATCTGAATCTCAGTTACTGCAATCTAATAGATGGAGGACTTCCGGAAGAGATTGGATCCTTATCCTCTTTGAAAAAGTTGGATCTCAGTAGAAATAATTTTGAGCATTTGCCTTCAAGTATAGCCCAACTTGGTGCTCTTCAATCCTTAGACTTAAAAGATTGCCAGAGGCTTACACAGCTACCAGAACTTCCCCCAGAATTAAATGAATTGCATGTAGATTGTCATATGGCTCTGAAATTTATCCATTATTTAGTAACAAAGAGAAAGAAACTACATAGAGTGAAACTTGATGATGCACACAATGATACTATGTACAATTTGTTTGCATATACCATGTTTCAGAATATCTCTTCCATGAGGCATGACATCTCTGCTTCAGATTCCTTGTCACTAACAGTATTTACCGGTCAACCGTATCCTGAAAAGATCCCGAGTTGGTTCCACCATCAGGGTTGGGATAGTAGTGTATCAGTCAATTTGCCTGAAAATTGGTATATACCTGATAAATTCTTGGGATTTGCTGTATGTTACTCTCGTAGCTTAATTGACACAACAGCTCACTTGATTCCCGTATGTGATGACAAGATGTCGCGCATGACCCAGAAACTTGCCTTATCAGAATGTGATACAGAATCATCCAACTATTCAGAATGGGATATACATTTTTTCTTTGTACCTTTTGCTGGCTTATGGGATACATCTAAGGCAAATGGAAAAACACCAAATGATTATGGGATTATTAGGCTATCTTTTTCTGGAGAAGAGAAGATGTATGGACTTCGTTTGTTGTATAAAGAAGGACCAGAGGTTAATGCCTTGTTACAAATGAGGGAAAATAGCAATGAACCAACAGAACATTCCACTGGGATAAGGAGGACTCAATATAACAACAGAACTTCCTTTTATGAGCTCATCAATGGGTGA



Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-154 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSSRWSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGS

Seg: seg
3-8 seg

SSSSSS

Gene3D: G3DSA:3.40.50.10140
7-145 no description

SSRWSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIAL

ProfileScan: PS50104
IPR000157
10-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANL

HMMSmart: SM00255
IPR000157
11-151 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANL

HMMPfam: PF01582
IPR000157
14-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALN

HMMPanther: PTHR11017
37-922 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIVNFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLV

HMMPanther: PTHR11017:SF20
37-922 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIVNFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLV

superfamily: SSF52540
181-419 P-loop containing nucleoside triphosphate hydrolases

SLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGI

Gene3D: G3DSA:3.40.50.300
184-336 no description

YLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLI

HMMPfam: PF00931
IPR002182
192-449 NB-ARC,NBS
NB-ARC

DTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEE

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

IMGIWGMGGVGKTTIA

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

RLRSKKVLIVLDDID

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

AKGLPLALKVWGSLL

superfamily: SSF52058
486-939 L domain-like,LRR

QMHDLIQDMGKYIVNFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLDDAHND

Gene3D: G3DSA:3.80.10.10
563-807 no description

SSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLN

HMMSmart: SM00369
IPR003591
595-617 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKMLVHLQLRHNSLRHLWTETKH

ProfileScan: PS51450
IPR001611
597-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLVHLQLRHNSLRHLWTETKHL

HMMSmart: SM00369
IPR003591
759-783 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLVSLSVSGCSKLESLPEEIGDL

Gene3D: G3DSA:3.80.10.10
808-908 no description

KLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELH

HMMSmart: SM00369
IPR003591
832-856 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHSLEYLNLSYCNLIDGGLPEEIGS

ProfileScan: PS51450
IPR001611
834-854 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLNLSYCNLIDGGLPEEI

HMMPfam: PF12799
834-874 LRR_4,Leucine Rich repeats (2 copies)

SLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLP

Seg: seg
856-866 seg

SLSSLKKLDLS

HMMSmart: SM00369
IPR003591
857-880 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLKKLDLSRNNFEHLPSSIAQL

ProfileScan: PS51450
IPR001611
859-880 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKKLDLSRNNFEHLPSSIAQL

FPrintScan: PR00364
IPR000767
878-894 DISEASERSIST
Disease resistance protein

AQLGALQSLDLKDCQRL

ProfileScan: PS51450
IPR001611
882-904 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQSLDLKDCQRLTQLPELPPEL

HMMPfam: PF13504
882-898 LRR_7,Leucine rich repeat

ALQSLDLKDCQRLTQLP

Seg: seg
897-907 seg

LPELPPELNEL


Diseases

Disease Pathogen Avirulence gene
Tobacco Mosaic Virus Tobacco mosaic virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox