PRGDB00000482 (At2)

From PRG Wiki
Jump to: navigation, search
At2
Gene Type Reference_R-Genes,_manually_curated
GenBank 18158220 (AF461048)
Gene Class Other
Domain Type Ser-Thr Kinase
Gene Species Cucumis melo

Comment?

Cucumis melo aminotransferase 2 mRNA, complete cds.

DNA Sequence

ATGGACTATGTTTATGGACCTGGAAGGAACCATCTTTTTGTGCCGGGGCCGGTTAATATCCCCGAACAAGTCCTTCGAGCAATGAACCGGAACAACGAGGATTATCGTTCTCCAGCTGTTCCAGCACTGACAAAGACTCTGCTTGAGGATGTCAAAAAGATATTCAAAACCACATCAGGCACTCCATTTTTGTTCCCTACCACAGGTACTGGTGCATGGGAGAGTGCTCTCACAAACACATTGTCTCCGGGAGATCGGATCGTGTCATTCCTTATTGGTCAATTCAGTTTGCTTTGGATTGATCAGCAACAGCGTCTCAATTTCAAAGTCGACGTGATTGAAAGTGAATGGGGTGAAGGTGCTAAGCTTGATGTTTTAGCTGCAAAGCTTGCAGCTGATACTGATCATACTATAAAGGCAGTTTGCATTGTTCATAATGAGACAGCAACTGGCGTGACTAATGATTTGTCTCTAGTAAGAAGAATACTACATGAATACAGGCATCCAGCTCTTTTCCTCGTGGATGGAGTGTCTTCGATATGTGCTCTTGATTTTCGTATGGATGATTGGGGAGTGGATGTGGCTTTAACTGGCTCTCAAAAAGCTCTTTCCCTTCCCACCGGAATTGGTATTGTTTGCGCCAGCCCCCGAGCACTCGAGGCATCTAAAACAGCAAAATCACTCAGAGTTTTCTTTGACTGGAAGGACTATCTCAAGTTCTATAACTTAGGAACATACTGGCCTTACACTCCTTCCATCCAACTCTTATATGGGCTTAGACCAGCTTTGGACCTCGTATTTGAGGAAGGCCTTGAAAATGTGATTGCGAGACATAAACGTTTAGGCCAAGCAACAAGGCTTGCTGTGGAGGCATGGGGTTTGAAGAACTGCACACAAAAGGAGGAATGGCACAGTGACACTGTGACTGCTGTTGTTGTTCCTCCATACATTGACAGTGCAGAAATTGTTAGAAGGGCTTGGAAGAGATACAATTTGAGTTTAGGTCTTGGCCTCAACAAAGTTGCTGGTAAAGTCTTCAGAATTGGCCACCTTGGCAACCTAAATGAGTTGCAACTGTTGGGTTGTCTTGCTGGTGTGGAGATGATTCTGAAGGATGTTGGTTATCCAGTGAAGCTTGGAAGTGGTGTTGCAGCAGCTTCTTCATATTTGCAGAACAACATCCCTCTCATTCCTTCTCGGATTTGA


Protein sequences

Name Description Sequence
aminotransferase 2 aminotransferase 2 [Cucumis melo].

MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152
1-401 PTHR21152,AMINOTRANSFERASE CLASS V

MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI

HMMPanther: PTHR21152:SF7
1-401 PTHR21152:SF7,SUBFAMILY NOT NAMED

MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI

HMMPIR: PIRSF000524
IPR024169
7-396 SPT
Serine-pyruvate aminotransferase/2-aminoethylphosp

PGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPL

superfamily: SSF53383
IPR015424
7-377 PyrdxlP-dep_Trfase_major
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

HMMPfam: PF00266
IPR000192
12-328 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWK

Gene3D: G3DSA:3.40.640.10
IPR015421
21-257 PyrdxlP-dep_Trfase_major_sub1
Pyridoxal phosphate-dependent transferase, major r

PEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEGAKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLY

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
258-383 PyrdxlP-dep_Trfase_major_sub2
Pyridoxal phosphate-dependent transferase, major r

GLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV


Diseases

Disease Pathogen Avirulence gene
Downy mildew mellon

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox