PRGDB00000483 (Hm1)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Hm1
Gene Type Reference_R-Genes,_manually_curated
GenBank 162463227 (NM_001112450)
Gene Class Other
Domain Type
Gene Species Zea mays

Comment?

Zea mays Helminthosporium carbonum susceptibility1 (hm1), mRNA.

DNA Sequence

ATGGCCGAAAAGGAGAGCAACGGAGTGCGGGTGTGCGTCACCGGAGGAGCCGGGTTCATCGGCTCCTGGCTCGTCAGGAAGCTCCTCGAGAAAGGCTACACCGTCCACGCCACCCTGCGGAACACCGGGGACGAGGCGAAGGCGGGGCTGCTGCGTCGGCTGGTCCCCGGCGCAGCGGAGCGGCTGCGGTTGTTCCAGGCCGACCTCTTCGACGCCGCCACCTTCGCGCCGGCGATCGCTGGGTGCCAGTTCGTCTTCCTCGTCGCCACGCCATTCGGGCTCGATAGCGCCGGCTCCCAGTATAAGAGCACGGCGGAAGCTGTGGTGGACGCGGTGCACGCGATCCTCCGGCAATGCGAGGAGTCCAGGACGGTGAAGCGAGTGATCCACACGGCCTCCGTAGCGGCCGCCTCGCCGCTGCTGGAGGAGGAGGTCCCCGCCTCCGGCGTCGGGTACAGAGACTTCATCGACGAATCTTGTTGGACTTCGCTCAACGTTGACTATCCTCTACGAAGCGCACACTTCGACAAGTACATACTGTCGAAGCTGCAGTCGGAGCAAGAGCTCCTGAGCTACAACAACGGCGAGAGTCCGGCGTTCGAGGTGGTGACCCTGCCGCTGGGGCTCGTGGCGGGCGACACGGTCCTCGGCCGCGCCCCGGAGACGGTGGAGAGCGCCGTGGCGCCCGTGTCCCGCAGCGAGCCCTACTTCGGCCTCCTGCGCATACTGCAGCAGCTCCTGGGGTCGCTGCCGCTGGTGCACGTGGACGACGTCTGCGACGCGCTCGTCTTCTGCATGGAGCGGCGCCCCTCCGTCGCCGGCCGCTTCCTCTGCGCCGCCGCGTACCCGACGATCCACGACGTGGTCGCCCACTACGCCAGCAAGTTCCCTCACCTCGACATCTTGAAAGAGACGACGGAGGCGGTGGCGACGGTGCGGCCTGCCCGGGACAGGTTGGGCGAGCTGGGCTTCAAGTACAAGTACGGCATGGAAGAGATTCTGGATAGCAGCGTTGCCTGTGCGGCGAGATTGGGTTCCCTTGACGGATCCAAGCTCGGCCTACAGAAAGGATAA


Protein sequences

Name Description Sequence
Helminthosporium carbonum susceptibility1 Helminthosporium carbonum susceptibility1 [Zea mays].

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLDGSKLGLQKG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF78
1-348 PTHR10366:SF78,OS06G0651100 PROTEIN

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLD

HMMPanther: PTHR10366
1-348 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAARLGSLD

superfamily: SSF51735
7-343 NAD(P)-bd

NGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETTEAVATVRPARDRLGELGFKYKYGMEEILDSSVACAAR

Gene3D: G3DSA:3.40.50.720
IPR016040
9-294 NAD(P)-bd
NAD(P)-binding domain

VRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYAS

HMMPfam: PF01370
IPR001509
11-269 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVHAILRQCEESRTVKRVIHTASVAAASPLLEEEVPASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLQSEQELLSYNNGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPYFGLLRILQQLLGSLPLVHVDDVCDALVFCMERR


Diseases

Disease Pathogen Avirulence gene
Leaf Spot

List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox