PRGDB00000485 (Hs1)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Hs1
Gene Type Reference_R-Genes,_manually_curated
GenBank 1850967 (U79733)
Gene Class Other
Domain Type
Gene Species Beta vulgaris

Comment?

Beta procumbens nematode resistance (Hs1pro-1) mRNA, complete cds.

DNA Sequence

ATGAGAAGGTGTGGGTATAGTTTGGGCCTTGGTGAGCCCAATTTGGACGGAAAGCCCAATTTAGATTACGACGCCGTTTGTCGTCCTTCTGAGCTTCACGCGCTTAAAAAGGGCGCGTTGGATTATATTCAGAATTCGGAAAATCAGATATTGTTTACAATTCATCAGATTTTCGAGTCGTGGATTTTTTCCTCGAAAAAATTGTTGGATCGAATAAGTGAGAGGATCAGTAAAGAAGAGTTTACCAAAGCAGCAGATGATTGTTGGATACTGGAGAAAATATGGAAGTTATTGGAGGAAATCGAGAATTTACATTTATTAATGGATCCTGACGATTTCCTGCATCTGAAGACGCAACTGAGGATGAAAACAGTGGCGGATTCTGAAACTTTTTGTTTTCGATCAAAAGGACTGATCGAGGTAACAAAATTAAGCAAGGATCTACGGCACAAGGTGCCGAAGATCCTTGGTGTAGAGGTGGACCCTATGGGAGGACCGGTGATACAAGAGTCGGCAATGGAGTTGTACCGAGAAAAAAGAAGATACGAGAAGATACATCTGTTACAAGCGTTTCAAGGGGTGGAATCCGCTGTTAAAGGGTTTTTCTTTAATTATAAACAGTTGTTGGTGATCATGATGGGTAGTTTGGAAGCGAAAGCGAATTTTGCTGTGATTGGTGGTTCTACTGAGTCTTCGGATTTGTTGGCTCAGTTGTTTTTAGAACCTACTTATTATCCGAGTTTGGATGGTGCCAAGACTTTTATTGGTGATTGTTGGGAGCATGATCAGGCTGTTGGTAGCGGCCTCGATTGTCGTCATCATCGGAAGAATCGGACTGCGAAACAATGA



Domains

Domain Start-End Description Sequence

HMMPfam: PF07014
IPR009743
1-262 Hs1pro-1_C
Hs1pro-1, C-terminal

MRRCGYSLGLGEPNLDGKPNLDYDAVCRPSELHALKKGALDYIQNSENQILFTIHQIFESWIFSSKKLLDRISERISKEEFTKAADDCWILEKIWKLLEEIENLHLLMDPDDFLHLKTQLRMKTVADSETFCFRSKGLIEVTKLSKDLRHKVPKILGVEVDPMGGPVIQESAMELYREKRRYEKIHLLQAFQGVESAVKGFFFNYKQLLVIMMGSLEAKANFAVIGGSTESSDLLAQLFLEPTYYPSLDGAKTFIGDCWEHD

superfamily: SSF140959
22-257 SSF140959

DYDAVCRPSELHALKKGALDYIQNSENQILFTIHQIFESWIFSSKKLLDRISERISKEEFTKAADDCWILEKIWKLLEEIENLHLLMDPDDFLHLKTQLRMKTVADSETFCFRSKGLIEVTKLSKDLRHKVPKILGVEVDPMGGPVIQESAMELYREKRRYEKIHLLQAFQGVESAVKGFFFNYKQLLVIMMGSLEAKANFAVIGGSTESSDLLAQLFLEPTYYPSLDGAKTFIGD


Diseases

Disease Pathogen Avirulence gene
Beet cyst nematode




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox