PRGDB00000486 (L6)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
L6
Gene Type Reference_R-Genes,_manually_curated
GenBank 862903 (U27081)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Gene Species Linum usitatissimum

Comment?

Linum usitatissimum alternatively spliced rust resistance (L6) gene, complete cds.

DNA Sequence

ATGAGTTATTTGAGAGAAGTTGCTACTGCTGTTGCCTTGCTTCTCCCTTTCATTCTTCTCAACAAGTTTTGGAGACCAAATTCCAAAGACTCAATCGTCAACGATGATGACGATTCAACATCTGAAGTTGATGCCATATCCGACTCCACAAATCCCTCTGGTTCATTTCCCTCCGTGGAGTATGAAGTGTTTTTGAGTTTCAGGGGTCCAGATACTCGTGAACAGTTCACCGATTTCCTATATCAGTCTCTCCGTCGCTATAAGATTCACACTTTTAGGGACGACGATGAGCTACTCAAAGGAAAAGAAATAGGGCCCAACCTCCTACGAGCAATTGATCAGTCCAAAATTTACGTCCCGATCATATCGAGCGGATATGCTGATAGTAAGTGGTGTCTTATGGAGCTTGCTGAAATTGTGAGACGTCAAGAGGAGGACCCTCGACGCATCATACTTCCTATTTTTTATATGGTGGATCCAAGTGACGTACGACATCAGACTGGATGTTATAAAAAAGCATTTCGAAAACACGCAAATAAATTTGATGGACAGACCATACAAAACTGGAAAGATGCTCTAAAGAAGGTCGGAGACTTAAAAGGATGGCACATCGGAAAGAATGACAAGCAGGGAGCTATAGCAGACAAAGTATCAGCAGATATATGGTCACACATAAGCAAGGAAAATCTCATTTTAGAAACCGATGAGTTGGTTGGAATTGATGATCACATAACAGCCGTATTAGAAAAATTGAGTTTAGACTCTGAAAATGTGACAATGGTCGGCCTTTATGGTATGGGTGGAATAGGCAAGACGACCACTGCAAAGGCGGTTTATAACAAGATTTCTTCTTGTTTCGATTGTTGTTGTTTTATTGACAACATACGTGAAACACAAGAGAAGGATGGCGTTGTTGTTTTGCAAAAGAAGCTAGTATCTGAAATTTTGAGGATCGATTCGGGTTCGGTTGGATTTAATAATGATAGTGGCGGACGGAAGACGATAAAGGAGAGAGTTTCGAGGTTCAAAATTCTTGTCGTTCTCGATGATGTGGATGAGAAGTTTAAATTTGAAGATATGTTGGGAAGTCCTAAAGATTTTATTTCTCAAAGTAGATTCATTATTACTTCAAGAAGTATGAGAGTTTTGGGTACTTTGAATGAGAATCAATGCAAGTTGTATGAAGTTGGATCGATGAGCAAACCACGTTCGCTTGAACTCTTCTCCAAGCATGCATTCAAAAAGAATACGCCTCCATCGTATTATGAGACTCTAGCAAATGACGTCGTAGATACTACAGCAGGACTTCCATTGACTCTGAAGGTTATAGGATCGCTTTTATTTAAACAAGAGATTGCGGTTTGGGAAGACACGTTGGAACAATTACGTAGAACACTTAACCTTGATGAGGTTTATGATAGGCTAAAAATAAGTTATGATGCGTTGAACCCGGAGGCAAAAGAGATTTTCTTGGATATAGCTTGCTTCTTCATCGGACAAAATAAAGAAGAACCGTATTACATGTGGACCGACTGTAATTTTTATCCAGCAAGTAATATTATTTTTCTCATTCAAAGATGTATGATACAAGTTGGGGATGATGATGAGTTTAAAATGCACGACCAACTTAGAGATATGGGTAGAGAAATTGTGAGACGAGAGGATGTACTGCCGTGGAAGAGAAGTAGAATATGGTCGGCAGAAGAAGGGATTGATCTCTTGCTGAACAAAAAGGGATCAAGTAAAGTAAAAGCAATTAGCATACCCTGGGGTGTCAAGTATGAGTTTAAGAGCGAATGTTTCTTGAATTTGTCAGAGTTGAGATACCTCCATGCAAGGGAAGCCATGCTTACCGGAGATTTCAACAATCTTCTCCCGAATTTAAAGTGGCTTGAGTTGCCATTTTACAAACATGGAGAGGATGATCCTCCTTTGACCAATTATACCATGAAAAATCTGATAATTGTTATTCTTGAGCATAGCCACATAACGGCTGATGATTGGGGAGGTTGGAGGCATATGATGAAGATGGCTGAGAGGCTGAAAGTTGTACGACTTGCTTCAAACTATAGTTTGTACGGAAGACGTGTTCGCCTTTCTGACTGTTGGCGCTTCCCCAAAAGCATTGAGGTATTATCCATGACTGCGATAGAAATGGATGAAGTTGATATTGGGGAGTTAAAGAAGCTAAAGACGTTGGTTCTGAAATTCTGTCCAATACAAAAGATAAGTGGGGGAACCTTTGGTATGTTGAAGGGACTTCGAGAGCTTTGTCTCGAATTCAACTGGGGGACAAATTTGAGAGAGGTAGTTGCCGATATTGGTCAACTTTCATCTCTCAAAGTCTTGAAAACAACCGGAGCTAAGGAGGTCGAGATTAATGAATTTCCATTAGGTTTGAAGGAGTTATCCACTTCATCTCGGATTCCGAATCTTTCACAGTTGTTGGATTTGGAGGTACTGAAGGTTTATGATTGCAAGGATGGATTTGACATGCCTCCTGCTAGTCCGAGTGAAGATGAAAGTAGTGTGTGGTGGAAGGTATCCAAGTTGAAGTCTTTGCAACTCGAGAAGACAAGAATCAATGTCAACGTTGTGGATGATGCTTCTTCCGGTGGTCACCTCCCTCGTTACTTACTACCAACATCCCTAACCTATCTTAAAATTTATCAGTGTACAGAACCAACGTGGCTTCCAGGAATAGAGAACTTGGAGAATTTGACTTCGCTGGAAGTCAACGACATCTTCCAAACTCTTGGAGGTGACTTGGATGGGCTACAAGGGTTGAGATCATTGGAAATTCTTAGGATTCGGAAAGTAAATGGTTTAGCTCGGATCAAAGGGCTTAAGGATCTCTTGTGTTCTTCTACCTGCAAGTTGCGGAAATTTTATATTACAGAATGCCCCGACCTCATTGAGTTACTCCCATGCGAACTCGGCGGCCAAACAGTAGTAGTCCCCTCTATGGCAGAACTGACCATTAGGGATTGTCCACGGCTGGAGGTTGGCCCGATGATAAGATCACTCCCAAAGTTCCCAATGCTAAAGAAGTTGGACCTCGCGGTGGCAAATATAACTAAAGAGGAGGATCTGGATGCGATTGGATCCCTAGAAGAGTTGGTTAGTTTGGAGTTAGAGTTAGACGATACATCTTCCGGTATAGAGAGGATAGTTTCCTCTTCGAAGCTGCAAAAGTTAACTACACTCGTAGTGAAGGTGCCGAGTTTGCGGGAGATTGAAGGGCTTGAAGAGTTGAAGTCTTTACAAGATTTGTATCTAGAGGGTTGCACGTCGTTGGGGAGACTACCACTGGAGAAGCTGAAGGAGCTAGACATTGGAGGATGCCCTGACCTCACTGAGTTAGTCCAAACAGTAGTAGCAGTCCCCTCTTTGAGAGGACTGACCATTAGGGATTGTCCACGGCTGGAGGTTGGTCCAATGATACAATCTCTTCCAAAGTTCCCAATGCTAAATGAATTGACGCTCTCGATGGTAAATATCACTAAGGAGGATGAGCTGGAGGTGCTTGGATCCCTAGAAGAGTTGGATAGTTTGGAGTTAACGTTAGACGATACATGTTCCAGCATAGAGAGGATATCTTTCTTGTCGAAGCTGCAAAAGTTAACTACACTCATAGTGGAGGTGCCGAGTTTGCGGGAGATTGAAGGTCTTGCAGAGTTGAAGTCTTTACGAATTTTGTATCTAGAAGGATGCACGTCGTTGGAAAGACTGTGGCCTGATCAACAACAGTTGGGTAGTCTGAAGAACCTGAATGTGCTCGACATCCAAGGTTGTAAAAGCTTGAGTGTTGACCATCTCTCTGCACTCAAGACCACTCTACCGCCCAGGGCGAGGATAACATGGCCCGATCAGCCCTACAGATGA


Protein sequences

Name Description Sequence
L6 L6.

MSYLREVATAVALLLPFILLNKFWRPNSKDSIVNDDDDSTSEVDAISDSTNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIWSHISKENLILETDELVGIDDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTPPSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTLNLDEVYDRLKISYDALNPEAKEIFLDIACFFIGQNKEEPYYMWTDCNFYPASNIIFLIQRCMIQVGDDDEFKMHDQLRDMGREIVRREDVLPWKRSRIWSAEEGIDLLLNKKGSSKVKAISIPWGVKYEFKSECFLNLSELRYLHAREAMLTGDFNNLLPNLKWLELPFYKHGEDDPPLTNYTMKNLIIVILEHSHITADDWGGWRHMMKMAERLKVVRLASNYSLYGRRVRLSDCWRFPKSIEVLSMTAIEMDEVDIGELKKLKTLVLKFCPIQKISGGTFGMLKGLRELCLEFNWGTNLREVVADIGQLSSLKVLKTTGAKEVEINEFPLGLKELSTSSRIPNLSQLLDLEVLKVYDCKDGFDMPPASPSEDESSVWWKVSKLKSLQLEKTRINVNVVDDASSGGHLPRYLLPTSLTYLKIYQCTEPTWLPGIENLENLTSLEVNDIFQTLGGDLDGLQGLRSLEILRIRKVNGLARIKGLKDLLCSSTCKLRKFYITECPDLIELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDTSSGIERIVSSSKLQKLTTLVVKVPSLREIEGLEELKSLQDLYLEGCTSLGRLPLEKLKELDIGGCPDLTELVQTVVAVPSLRGLTIRDCPRLEVGPMIQSLPKFPMLNELTLSMVNITKEDELEVLGSLEELDSLELTLDDTCSSIERISFLSKLQKLTTLIVEVPSLREIEGLAELKSLRILYLEGCTSLERLWPDQQQLGSLKNLNVLDIQGCKSLSVDHLSALKTTLPPRARITWPDQPYR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
49-202 TIR
Toll/interleukin-1 receptor homology (TIR) domain

STNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGW

ProfileScan: PS50104
IPR000157
59-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDL

Gene3D: G3DSA:3.40.50.10140
59-196 G3DSA:3.40.50.10140

VEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKV

HMMSmart: SM00255
IPR000157
60-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDL

HMMPfam: PF01582
IPR000157
63-194 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALK

HMMPanther: PTHR11017
86-1270 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIWSHISKENLILETDELVGIDDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTPPSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTLNLDEVYDRLKISYDALNPEAKEIFLDIACFFIGQNKEEPYYMWTDCNFYPASNIIFLIQRCMIQVGDDDEFKMHDQLRDMGREIVRREDVLPWKRSRIWSAEEGIDLLLNKKGSSKVKAISIPWGVKYEFKSECFLNLSELRYLHAREAMLTGDFNNLLPNLKWLELPFYKHGEDDPPLTNYTMKNLIIVILEHSHITADDWGGWRHMMKMAERLKVVRLASNYSLYGRRVRLSDCWRFPKSIEVLSMTAIEMDEVDIGELKKLKTLVLKFCPIQKISGGTFGMLKGLRELCLEFNWGTNLREVVADIGQLSSLKVLKTTGAKEVEINEFPLGLKELSTSSRIPNLSQLLDLEVLKVYDCKDGFDMPPASPSEDESSVWWKVSKLKSLQLEKTRINVNVVDDASSGGHLPRYLLPTSLTYLKIYQCTEPTWLPGIENLENLTSLEVNDIFQTLGGDLDGLQGLRSLEILRIRKVNGLARIKGLKDLLCSSTCKLRKFYITECPDLIELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDTSSGIERIVSSSKLQKLTTLVVKVPSLREIEGLEELKSLQDLYLEGCTSLGRLPLEKLKELDIGGCPDLTELVQTVVAVPSLRGLTIRDCPRLEVGPMIQSLPKFPMLNELTLSMVNITKEDELEVLGSLEELDSLELTLDDTCSSIERISFLSKLQKLTTLIVEVPSLREIEGLAELKSLRILYLEGCTSLERLWPDQQQLGSLKNLNVLDIQGCKSLSV

HMMPanther: PTHR11017:SF20
86-1270 PTHR11017:SF20,SUBFAMILY NOT NAMED

RYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIWSHISKENLILETDELVGIDDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTPPSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTLNLDEVYDRLKISYDALNPEAKEIFLDIACFFIGQNKEEPYYMWTDCNFYPASNIIFLIQRCMIQVGDDDEFKMHDQLRDMGREIVRREDVLPWKRSRIWSAEEGIDLLLNKKGSSKVKAISIPWGVKYEFKSECFLNLSELRYLHAREAMLTGDFNNLLPNLKWLELPFYKHGEDDPPLTNYTMKNLIIVILEHSHITADDWGGWRHMMKMAERLKVVRLASNYSLYGRRVRLSDCWRFPKSIEVLSMTAIEMDEVDIGELKKLKTLVLKFCPIQKISGGTFGMLKGLRELCLEFNWGTNLREVVADIGQLSSLKVLKTTGAKEVEINEFPLGLKELSTSSRIPNLSQLLDLEVLKVYDCKDGFDMPPASPSEDESSVWWKVSKLKSLQLEKTRINVNVVDDASSGGHLPRYLLPTSLTYLKIYQCTEPTWLPGIENLENLTSLEVNDIFQTLGGDLDGLQGLRSLEILRIRKVNGLARIKGLKDLLCSSTCKLRKFYITECPDLIELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDTSSGIERIVSSSKLQKLTTLVVKVPSLREIEGLEELKSLQDLYLEGCTSLGRLPLEKLKELDIGGCPDLTELVQTVVAVPSLRGLTIRDCPRLEVGPMIQSLPKFPMLNELTLSMVNITKEDELEVLGSLEELDSLELTLDDTCSSIERISFLSKLQKLTTLIVEVPSLREIEGLAELKSLRILYLEGCTSLERLWPDQQQLGSLKNLNVLDIQGCKSLSV

superfamily: SSF52540
220-466 SSF52540

DIWSHISKENLILETDELVGIDDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTPPSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTL

Gene3D: G3DSA:3.40.50.300
235-370 G3DSA:3.40.50.300

DELVGIDDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQ

HMMPfam: PF00931
IPR002182
241-519 NB-ARC,NBS
NB-ARC

DDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKISSCFDCCCFIDNIRETQEKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKERVSRFKILVVLDDVDEKFKFEDMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTPPSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTLNLDEVYDRLKISYDALNPEAKEIFLDIACFFIGQNKEEPYYMWTDCNFYPASN

FPrintScan: PR00364
IPR000767
260-275 DISEASERSIST
Disease resistance protein

MVGLYGMGGIGKTTTA

FPrintScan: PR00364
IPR000767
338-352 DISEASERSIST
Disease resistance protein

RVSRFKILVVLDDVD

FPrintScan: PR00364
IPR000767
433-447 DISEASERSIST
Disease resistance protein

TAGLPLTLKVIGSLL

superfamily: SSF46785
469-575 SSF46785

DEVYDRLKISYDALNPEAKEIFLDIACFFIGQNKEEPYYMWTDCNFYPASNIIFLIQRCMIQVGDDDEFKMHDQLRDMGREIVRREDVLPWKRSRIWSAEEGIDLLL

superfamily: SSF52047
596-1050 SSF52047,LRR

FKSECFLNLSELRYLHAREAMLTGDFNNLLPNLKWLELPFYKHGEDDPPLTNYTMKNLIIVILEHSHITADDWGGWRHMMKMAERLKVVRLASNYSLYGRRVRLSDCWRFPKSIEVLSMTAIEMDEVDIGELKKLKTLVLKFCPIQKISGGTFGMLKGLRELCLEFNWGTNLREVVADIGQLSSLKVLKTTGAKEVEINEFPLGLKELSTSSRIPNLSQLLDLEVLKVYDCKDGFDMPPASPSEDESSVWWKVSKLKSLQLEKTRINVNVVDDASSGGHLPRYLLPTSLTYLKIYQCTEPTWLPGIENLENLTSLEVNDIFQTLGGDLDGLQGLRSLEILRIRKVNGLARIKGLKDLLCSSTCKLRKFYITECPDLIELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDT

Gene3D: G3DSA:3.80.10.10
598-789 G3DSA:3.80.10.10

SECFLNLSELRYLHAREAMLTGDFNNLLPNLKWLELPFYKHGEDDPPLTNYTMKNLIIVILEHSHITADDWGGWRHMMKMAERLKVVRLASNYSLYGRRVRLSDCWRFPKSIEVLSMTAIEMDEVDIGELKKLKTLVLKFCPIQKISGGTFGMLKGLRELCLEFNWGTNLREVVADIGQLSSLKVLKTTGAK

Gene3D: G3DSA:3.80.10.10
803-961 G3DSA:3.80.10.10

LSTSSRIPNLSQLLDLEVLKVYDCKDGFDMPPASPSEDESSVWWKVSKLKSLQLEKTRINVNVVDDASSGGHLPRYLLPTSLTYLKIYQCTEPTWLPGIENLENLTSLEVNDIFQTLGGDLDGLQGLRSLEILRIRKVNGLARIKGLKDLLCSSTCKLR

Gene3D: G3DSA:3.80.10.10
962-1141 G3DSA:3.80.10.10

KFYITECPDLIELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDTSSGIERIVSSSKLQKLTTLVVKVPSLREIEGLEELKSLQDLYLEGCTSLGRLPLEKLKELDIGGCPDLTELVQTVVAVPSLRGLTIRDCPR

superfamily: SSF52058
972-1278 SSF52058,LRR

IELLPCELGGQTVVVPSMAELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANITKEEDLDAIGSLEELVSLELELDDTSSGIERIVSSSKLQKLTTLVVKVPSLREIEGLEELKSLQDLYLEGCTSLGRLPLEKLKELDIGGCPDLTELVQTVVAVPSLRGLTIRDCPRLEVGPMIQSLPKFPMLNELTLSMVNITKEDELEVLGSLEELDSLELTLDDTCSSIERISFLSKLQKLTTLIVEVPSLREIEGLAELKSLRILYLEGCTSLERLWPDQQQLGSLKNLNVLDIQGCKSLSVDHLSALKT

FPrintScan: PR00364
IPR000767
1083-1099 DISEASERSIST
Disease resistance protein

EELKSLQDLYLEGCTSL

Gene3D: G3DSA:3.80.10.10
1146-1277 G3DSA:3.80.10.10

PMIQSLPKFPMLNELTLSMVNITKEDELEVLGSLEELDSLELTLDDTCSSIERISFLSKLQKLTTLIVEVPSLREIEGLAELKSLRILYLEGCTSLERLWPDQQQLGSLKNLNVLDIQGCKSLSVDHLSALK


Diseases

Disease Pathogen Avirulence gene
Flax rust

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox