PRGDB00000489 (RCY1)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RCY1
Gene Type Reference_R-Genes,_manually_curated
GenBank 29603481 (AB087829)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RCY1 gene for R-protein, complete cds.

DNA Sequence

ATGGCTGAAGGATTTGTGTCGTTTGGGCTTCAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGAGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGCTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAACTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGAGGAGAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTCGCTTCTTAACGGATCGCCACAAAGTTGCTTCAGATATCGAGGGTATAACTAAGAGGATCTCTGAAGTGATTGGGGAAATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTAAAGAATTGGTTGGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGCAAAACCACTCTGGCTAGACAAGTCTTTCATCATGACTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCCCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATATGCACTTCAGCGTAAACTCTTTCAATTGTTAGAGGCCGGTAGATATTTAGTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATCGAATAAAAGCAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGCGTTGGGAGGCTTGTTAGCTAATAAACATACTGTTCCTGAGTGGAAAAGAGTTTTTGACAATATTGGATCTCAAATAGTAGGAGGATCGGGCTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATTGTTTCCTTTACCTAGCCCATTTCCCTGAAGATTCCAAGATATATAGGCATGGTTTGTTCAATTACTGGGCAGTAGAAGGGATTTACGATGGATCAACCATCGAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACAACAAAAATTTGGATTGGCATTCTAAATATTGTCAAATGCACGACATGATGAGAGAAGTATGTTTACCTAAAGCCAAAGAAGAGAACTTCCTACAAATTATCAAAGACCCTACTTGCACCTCTACCATCAATGCTCAATCTCCTAGTAGATCTCGCAGACTCAGCATACATAGTGGTAAAGCCTTTCATATATTGGGACACAGAAACAATGCAAAGGTGAGATCTCTCATAGTTTTGAGATTAAAGGAGGAAGACTATTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTTGGGTAAAGTTTGAAGGAGGGAAGTTACCTTGTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGTTTATGCGGGGCTGGGGTATCTCATCTACCTTCTACTATGCGGAACTTAAAGCTTCTGCTCTATTTGAACTTAAATGTTGATAACGAGGAACTGATTCACGTGCCAAATGTTTTGAAAGAGATGATAGAGTTGAGGTACCTTTCCCTACCTATTAAAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTTCTTGTTTGGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCATATGACTAAGCTCCGGTATCTCGCTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGCGAATTGCGAAACCTCGAAACGCTTAATTTCCTCTTTACGCCCCAAACCTATATGGTTGATCATATGGGAGTGTTTGTTCTGGATCATTTTATTCATCTAAAAGAGTTGGGATTGGCAGTATCTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGTACACATATTTCTATTTTATTGCGGCATGGAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTAAAGTCGGTTGAATTGTCAAATAAGGCTTTCGCTGGAAGGAGAATGGTGTGCTCAAAAGGCGGATTTACTCAATTATGTGCCCTAGAAATATCTGAACAATTGGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATACATGATTGCAAAAAGTTGAAGGAACTTCCAGATGGACTCAAGTACATAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCAGTAG


Protein sequences

Name Description Sequence
R-protein R-protein [Arabidopsis thaliana].

MAEGFVSFGLQKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSGLDDNSLNSVYRILSLSYEDLPTHLKHCFLYLAHFPEDSKIYRHGLFNYWAVEGIYDGSTIEDSGEYYLEELVRRNLVIADNKNLDWHSKYCQMHDMMREVCLPKAKEENFLQIIKDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHRNNAKVRSLIVLRLKEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLCGAGVSHLPSTMRNLKLLLYLNLNVDNEELIHVPNVLKEMIELRYLSLPIKMDDKTKLELGDLVNLEFLFGFSTQHSSVTDLLHMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFTPQTYMVDHMGVFVLDHFIHLKELGLAVSMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLLHLKSVELSNKAFAGRRMVCSKGGFTQLCALEISEQLELEEWIVEEGSMPCLRTLTIHDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-905 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEGFVSFGLQKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSGLDDNSLNSVYRILSLSYEDLPTHLKHCFLYLAHFPEDSKIYRHGLFNYWAVEGIYDGSTIEDSGEYYLEELVRRNLVIADNKNLDWHSKYCQMHDMMREVCLPKAKEENFLQIIKDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHRNNAKVRSLIVLRLKEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLCGAGVSHLPSTMRNLKLLLYLNLNVDNEELIHVPNVLKEMIELRYLSLPIKMDDKTKLELGDLVNLEFLFGFSTQHSSVTDLLHMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFTPQTYMVDHMGVFVLDHFIHLKELGLAVSMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLLHLKSVELSNKAFAGRRMVCSKGGFTQLCALEISEQLELEEWIVEEGSMPCLRTLTIHDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155
2-905 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGFVSFGLQKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSGLDDNSLNSVYRILSLSYEDLPTHLKHCFLYLAHFPEDSKIYRHGLFNYWAVEGIYDGSTIEDSGEYYLEELVRRNLVIADNKNLDWHSKYCQMHDMMREVCLPKAKEENFLQIIKDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHRNNAKVRSLIVLRLKEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLCGAGVSHLPSTMRNLKLLLYLNLNVDNEELIHVPNVLKEMIELRYLSLPIKMDDKTKLELGDLVNLEFLFGFSTQHSSVTDLLHMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFTPQTYMVDHMGVFVLDHFIHLKELGLAVSMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLLHLKSVELSNKAFAGRRMVCSKGGFTQLCALEISEQLELEEWIVEEGSMPCLRTLTIHDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

superfamily: SSF52540
143-393 SSF52540

LQERQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVG

HMMPfam: PF00931
IPR002182
166-452 NB-ARC,NBS
NB-ARC

EQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSGLDDNSLNSVYRILSLSYEDLPTHLKHCFLYLAHFPEDSKIYRHGLFNYWAVEGIYD

Gene3D: G3DSA:3.40.50.300
167-286 G3DSA:3.40.50.300

QSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDRIKAVFP

FPrintScan: PR00364
IPR000767
184-199 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

LLEAGRYLVVLDDVW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CGGLPLAVKALGGLL

superfamily: SSF52058
488-874 SSF52058,LRR

QMHDMMREVCLPKAKEENFLQIIKDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHRNNAKVRSLIVLRLKEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLCGAGVSHLPSTMRNLKLLLYLNLNVDNEELIHVPNVLKEMIELRYLSLPIKMDDKTKLELGDLVNLEFLFGFSTQHSSVTDLLHMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFTPQTYMVDHMGVFVLDHFIHLKELGLAVSMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLLHLKSVELSNKAFAGRRMVCSKGGFTQLCALEISEQLELEEWIVEEGSMPCLRTLTIHDCKKLKELPDGLKYITSLKELKIEG

Gene3D: G3DSA:3.80.10.10
550-641 G3DSA:3.80.10.10

RSLIVLRLKEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLCGAGVSHLPSTMRNLKLLLYLNLNVDNEELIHVPN

Gene3D: G3DSA:3.80.10.10
642-715 G3DSA:3.80.10.10

VLKEMIELRYLSLPIKMDDKTKLELGDLVNLEFLFGFSTQHSSVTDLLHMTKLRYLAVSLSERCNFETLSSSLR

Gene3D: G3DSA:3.80.10.10
716-873 G3DSA:3.80.10.10

ELRNLETLNFLFTPQTYMVDHMGVFVLDHFIHLKELGLAVSMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPILEKLLHLKSVELSNKAFAGRRMVCSKGGFTQLCALEISEQLELEEWIVEEGSMPCLRTLTIHDCKKLKELPDGLKYITSLKELKIE

FPrintScan: PR00364
IPR000767
838-854 DISEASERSIST
Disease resistance protein

GSMPCLRTLTIHDCKKL


Diseases

Disease Pathogen Avirulence gene
Cucumber Mosaic Virus Cucumber mosaic virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox