PRGDB00000491 (RPM1)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPM1
Gene Type Reference_R-Genes,_manually_curated
GenBank 30680118 (NM_111584)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1); protein binding (RPM1) mRNA, complete cds.

DNA Sequence

ATGGCTTCGGCTACTGTTGATTTTGGGATCGGACGGATTCTTAGTGTCCTGGAAAACGAGACCTTGTTATTGTCAGGAGTCCATGGTGAGATTGATAAAATGAAGAAGGAGTTGCTGATCATGAAGTCCTTTCTTGAGGATACTCATAAACATGGTGGAAATGGATCCACAACAACAACAACTCAACTCTTCCAAACTTTTGTGGCAAACACGAGAGATTTGGCTTACCAAATCGAAGACATTCTCGACGAGTTTGGCTATCACATCCACGGTTATCGTAGCTGCGCCAAAATTTGGCGTGCGTTTCATTTCCCGAGGTATATGTGGGCGAGGCACTCGATAGCTCAAAAGCTAGGAATGGTTAATGTCATGATTCAATCCATTTCTGATTCCATGAAAAGGTACTATCATTCAGAAAACTACCAAGCAGCATTATTACCGCCTATTGATGATGGCGATGCAAAGTGGGTGAACAACATCAGTGAGTCATCTCTTTTCTTTAGTGAAAATAGTCTTGTAGGGATTGATGCACCCAAGGGAAAGCTCATCGGACGGCTTCTAAGTCCCGAACCTCAGCGGATTGTTGTCGCGGTGGTTGGGATGGGCGGTTCAGGGAAAACTACACTCTCAGCGAATATCTTCAAGTCTCAAAGTGTGCGGAGGCATTTTGAGTCTTACGCTTGGGTTACAATCTCGAAATCTTATGTGATTGAAGATGTGTTTAGGACCATGATCAAGGAGTTTTACAAAGAAGCAGATACACAGATTCCAGCTGAATTATACTCCTTAGGCTACAGAGAGTTGGTGGAAAAACTTGTGGAGTATTTGCAGTCGAAGAGGTACATTGTTGTGCTTGATGATGTATGGACCACTGGTCTATGGAGGGAGATAAGTATTGCTTTACCAGATGGTATTTATGGAAGTCGTGTTATGATGACTACTCGGGACATGAACGTGGCTTCTTTCCCATATGGAATTGGGAGCACAAAGCACGAGATTGAGCTCTTAAAAGAAGACGAAGCTTGGGTGCTTTTCTCCAACAAAGCTTTTCCGGCAAGTCTTGAGCAATGCAGAACGCAGAATTTGGAGCCGATAGCACGAAAATTAGTCGAGAGATGTCAGGGTTTGCCATTAGCTATTGCTTCTTTGGGAAGCATGATGTCAACCAAGAAGTTTGAATCAGAATGGAAGAAAGTCTACAGTACTTTAAACTGGGAACTGAACAACAATCATGAACTCAAGATTGTTCGAAGCATTATGTTCCTTAGCTTCAATGATTTGCCATACCCGCTTAAACGTTGTTTCTTATATTGTTCTCTTTTCCCTGTGAACTATCGGATGAAAAGAAAGAGGCTCATTAGGATGTGGATGGCACAAAGGTTTGTGGAACCGATCAGAGGAGTGAAAGCAGAAGAAGTGGCTGATAGTTACCTCAATGAACTTGTTTACAGAAATATGCTTCAAGTTATCTTGTGGAATCCTTTTGGACGACCCAAGGCGTTCAAGATGCATGACGTGATATGGGAGATTGCTCTATCTGTATCCAAACTTGAGAGGTTCTGTGATGTATATAATGATGACAGTGATGGTGATGATGCTGCAGAAACAATGGAGAATTACGGTAGTCGCCATTTATGCATTCAGAAAGAGATGACACCTGATAGTATACGTGCAACAAACCTTCACTCTCTTTTGGTTTGCTCTTCTGCTAAACACAAGATGGAATTACTTCCAAGTCTGAACCTTCTGAGAGCCTTAGACCTTGAAGACTCTTCCATCAGCAAGTTACCAGATTGTTTAGTAACTATGTTCAACTTAAAGTACTTGAATTTGTCCAAGACACAGGTGAAAGAACTGCCAAAAAACTTCCATAAACTCGTCAATTTGGAGACGTTGAACACAAAGCACTCCAAGATTGAGGAACTTCCTCTAGGGATGTGGAAATTGAAGAAGTTGCGATATCTCATTACTTTTCGCCGCAATGAAGGACATGATTCCAATTGGAATTATGTTTTAGGTACAAGGGTTGTTCCTAAAATCTGGCAGTTGAAGGATTTGCAAGTCATGGACTGCTTCAACGCAGAAGATGAGCTTATCAAAAATCTCGGGTGTATGACTCAGCTCACAAGAATAAGTCTTGTCATGGTTAGGAGAGAACATGGAAGAGACTTGTGCGATTCACTGAATAAGATTAAAAGAATTCGATTCTTATCTTTAACGTCGATTGATGAAGAGGAACCGTTAGAGATAGATGACCTGATCGCAACTGCAAGCATTGAGAAGCTCTTTCTTGCTGGGAAACTGGAGAGAGTACCAAGTTGGTTCAACACTCTTCAAAACCTTACCTATTTGGGTTTGCGTGGATCTCAGCTACAGGAAAACGCCATTCTCTCTATCCAAACGCTTCCTAGATTGGTATGGCTTTCATTTTACAATGCATACATGGGACCTAGGTTGCGTTTTGCACAAGGATTTCAGAATCTGAAGATTCTAGAGATAGTTCAGATGAAACATCTGACAGAAGTTGTTATAGAAGACGGTGCAATGTTTGAGCTTCAGAAGCTTTATGTCAGGGCTTGTAGAGGGTTAGAGTACGTACCAAGAGGAATTGAGAATCTTATAAATCTTCAAGAACTGCATTTGATTCATGTTTCTAATCAGTTAGTAGAACGCATTCGCGGAGAAGGGAGTGTGGACCGGTCAAGGGTTAAACACATTCCTGCGATTAAGCATTATTTCAGAACTGATAATGGCTCTTTCTATGTGAGCCTCTCATCTTAG


Protein sequences

Name Description Sequence
RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1); protein binding RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1); protein binding [Arabidopsis thaliana].

MASATVDFGIGRILSVLENETLLLSGVHGEIDKMKKELLIMKSFLEDTHKHGGNGSTTTTTQLFQTFVANTRDLAYQIEDILDEFGYHIHGYRSCAKIWRAFHFPRYMWARHSIAQKLGMVNVMIQSISDSMKRYYHSENYQAALLPPIDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFESYAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMELLPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEPLEIDDLIATASIEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIHVSNQLVERIRGEGSVDRSRVKHIPAIKHYFRTDNGSFYVSLSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF234
2-926 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

ASATVDFGIGRILSVLENETLLLSGVHGEIDKMKKELLIMKSFLEDTHKHGGNGSTTTTTQLFQTFVANTRDLAYQIEDILDEFGYHIHGYRSCAKIWRAFHFPRYMWARHSIAQKLGMVNVMIQSISDSMKRYYHSENYQAALLPPIDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFESYAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMELLPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEPLEIDDLIATASIEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIHVSNQLVERIRGEGSVDRSRVKHIPAIKHYFRTDNGSFYVSLSS

HMMPanther: PTHR23155
2-926 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASATVDFGIGRILSVLENETLLLSGVHGEIDKMKKELLIMKSFLEDTHKHGGNGSTTTTTQLFQTFVANTRDLAYQIEDILDEFGYHIHGYRSCAKIWRAFHFPRYMWARHSIAQKLGMVNVMIQSISDSMKRYYHSENYQAALLPPIDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFESYAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMELLPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEPLEIDDLIATASIEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIHVSNQLVERIRGEGSVDRSRVKHIPAIKHYFRTDNGSFYVSLSS

superfamily: SSF52540
155-411 SSF52540

KWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFESYAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNH

HMMPfam: PF00931
IPR002182
177-465 NB-ARC,NBS
NB-ARC

APKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFESYAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFVEPI

Gene3D: G3DSA:3.40.50.300
190-218 G3DSA:3.40.50.300

EPQRIVVAVVGMGGSGKTTLSANIFKSQS

FPrintScan: PR00364
IPR000767
195-210 DISEASERSIST
Disease resistance protein

VVAVVGMGGSGKTTLS

FPrintScan: PR00364
IPR000767
275-289 DISEASERSIST
Disease resistance protein

YLQSKRYIVVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CQGLPLAIASLGSMM

superfamily: SSF52058
502-883 SSF52058,LRR

KMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMELLPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEPLEIDDLIATASIEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIH

Gene3D: G3DSA:3.80.10.10
577-655 G3DSA:3.80.10.10

LPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYL

FPrintScan: PR00364
IPR000767
578-594 DISEASERSIST
Disease resistance protein

PSLNLLRALDLEDSSIS

HMMPfam: PF00560
IPR001611
605-626 LRR_1
Leucine-rich repeat

NLKYLNLSKTQVKELPKNFHKL

Gene3D: G3DSA:3.80.10.10
679-884 G3DSA:3.80.10.10

KIWQLKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEPLEIDDLIATASIEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIHV


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Pseudomonas syringae PRGAV00000043
Bacterial Blight Pseudomonas syringae PRGAV00000043




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox