PRGDB00000493 (RPP5)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPP5
Gene Type Reference_R-Genes,_manually_curated
GenBank 186511938 (NM_117798)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPP5 (RECOGNITION OF PERONOSPORA PARASITICA 5) (RPP5) mRNA, complete cds.

DNA Sequence

ATGGCGGCTTCTTCTTCTTCTGGCAGACGGAGATACGACGTTTTTCCAAGCTTCAGTGGGGTTGATGTTCGCAAGACGTTCCTCAGCCATCTAATCGAGGCGCTCGACGGCAAATCAATCAATACATTCATCGATCATGGAATCGAGAGAAGCCGCACAATCGCCCCTGAGCTTATATCGGCGATTAGAGAAGCTAGGATCTCAATCGTCATCTTCTCTAAGAACTATGCTTCTTCAACGTGGTGCTTAAATGAATTGGTTGAGATCCACAAGTGCTTTAATGATTTAGGTCAAATGGTGATTCCAGTTTTCTACGACGTTGATCCTTCGGAAGTTAGAAAACAGACCGGCGAATTTGGAAAGGTCTTTGAAAAGACATGCGAGGTCAGCAAGGACAAACAACCAGGGGATCAGAAACAAAGATGGGTGCAAGCTCTCACAGATATAGCAAATATAGCCGGAGAGGATCTTCTGAACGGGCCTAATGAAGCGCATATGGTTGAAAAGATATCCAATGATGTTTCGAATAAACTTATCACTCGGTCAAAGTGTTTTGATGACTTCGTCGGAATTGAAGCTCATATTGAGGCAATAAAATCAGTATTGTGCTTGGAATCCAAGGAAGCTAGAATGGTCGGGATTTGGGGACAATCAGGGATTGGTAAGAGTACCATAGGAAGAGCTCTTTTCAGTCAACTCTCTATCCAATTCCCCCTTCGCGCTTTCCTAACTTATAAAAGCACCAGTGGTAGTGACGTCTCTGGCATGAAGTTGAGTTGGGAAAAAGAACTTCTCTCTGAAATCTTAGGTCAAAAGGACATAAAGATAGAGCATTTTGGTGTGGTGGAGCAAAGGTTGAAGCACAAGAAAGTTCTTATCCTTCTTGATGATGTGGATAATCTAGAGTTTCTTAAGACCTTGGTGGGAAAAGCTGAATGGTTTGGATCGGGAAGCAGAATTATTGTGATCACTCAAGATAGGCAATTTCTCAAGGCTCATGACATTGACCTTGTATATGAGGTGAAGCTGCCATCTCAAGGTCTTGCTCTTACGATGTTATGCCGATCTGCTTTTGGGAAAGACTCTCCACCTGATGATTTTAAGGAACTAGCATTTGAAGTTGCGAAGCTTGCCGGCCATCTTCCTTTGGGTCTCAATGTCCTGGGTTCGTCATTAAGAAGAAGGGGCAAAAAAGAGTGGATGGAGATGATGCCTAGGCTCCGAAATGGTTTGAACGGAGATATTATGAAAACATTAAGAGTCAGCTACGATAGATTACATCAAAAAGATCAAGATATGTTCCTTTGCATTGCGTGTTTATTCAATGGTTTTGAGGTCAGTTACGTCAAAGATTTACTTGAAGATAATGTTGGGCTTACAATGTTGTCTGAGAAGTCCCTCATACGTATTACACCGGATGGACATATAGAGATGCACAATTTGCTAGAGAAATTGGGTAGAGAAATTGATCGTGCAAAGTCCAAGGGTAATCCTGGAAAACGTCAATTTCTGACGAATTTTGAGGATATTCATGAAGTAGTGACCGAGAAAACTGGGACAGAAACTCTTCTTGGAATACGTTTGCCATTCGAGGAATATTTTTCGACAAGGCCGTTATTAATAGATAAAGAATCGTTCAAAGGCATGCGTAATCTCCAATATCTAAAAATTGGTGATTGGTCAGATGGGGGTCAACCTCAGAGCCTCGTTTATTTGCCCCTTAAACTCAGATTGCTAGACTGGGATGATTGTCCATTGAAGTCTTTGCCATCTACTTTTAAGGCGGAATATCTAGTTAACCTCATAATGAAGTATAGTAAGCTTGAGAAACTGTGGGAAGGAACTCTGCCCCTTGGAAGTCTCAAGAAGATGAATTTGTTGTGTTCCAAAAATTTGAAAGAAATTCCAGATCTTTCTAATGCCAGAAACCTCGAGGAATTAGATCTTGAAGGATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCATTAAACTGAGGAAGTTACATTGTTCGGGGGTGATATTAATAGATTTAAAATCATTAGAAGGCATGTGTAATCTCGAATATCTATCAGTTGATTGCTCACGTGTGGAAGGCACTCAGGGCATCGTTTATTTCCCTAGTAAACTCAGATTGCTATTGTGGAATAATTGTCCATTGAAGCGTTTGCATTCTAATTTTAAGGTTGAGTATCTGGTTAAACTCAGAATGGAGAATAGTGACCTTGAGAAGCTGTGGGATGGAACTCAGCCACTTGGAAGACTCAAGCAGATGTTTCTGCGTGGTTCCAAATATTTGAAAGAGATTCCAGATCTTTCTTTAGCCATAAACCTCGAGGAAGTAGATATTTGTAAATGCGAATCCTTGGTGACATTTCCTTCCTCGATGCAGAATGCCATTAAACTTATCTATTTAGATATTAGTGATTGCAAAAAGCTAGAGAGTTTTCCAACCGATCTCAACTTGGAATCTCTCGAGTACCTCAATCTCACTGGATGCCCGAATTTGAGAAATTTCCCAGCAATCAAAATGGGATGTTCAGACGTTGACTTTCCGGAAGGGAGAAATGAGATCGTGGTAGAAGATTGTTTCTGGAACAAGAATCTCCCTGCTGGACTAGATTATCTCGACTGCCTTATGAGATGTATGCCTTGTGAATTTCGCCCAGAATATCTCGTTTTTCTCAATGTGAGGTGCTACAAGCATGAGAAGCTATGGGAAGGCATCCAGTCGCTTGGAAGTCTCGAAGAGATGGATCTGTCAGAATCTGAAAACCTGACAGAAATTCCAGATCTTTCAAAGGCCACCAATCTGAAGCATTTATATCTCAACAACTGCAAAAGTTTGGTGACACTTCCTTCTACTATTGGGAATCTCCAAAAATTGGTGAGGTTGGAAATGAAAGAATGCACAGGGCTGGAGGTTCTTCCAACCGATGTCAACTTGTCATCTCTCGAAACCCTCGATCTCAGTGGTTGCTCAAGTTTGAGAACTTTTCCTCTGATTTCAAAGAGTATCAAATGGCTCTATCTGGAAAACACCGCCATTGAAGAAATTCTAGATCTTTCAAAGGCCACCAAGCTCGAGTCTTTGATACTCAACAACTGCAAAAGTTTGGTGACACTTCCTTCTACAATTGGGAATCTTCAAAATTTGAGACGTTTGTACATGAAAAGATGCACAGGGCTGGAGGTTCTTCCAACCGATGTCAACTTGTCATCTCTGGGTATCCTCGATCTCAGTGGTTGCTCAAGTTTGAGAACTTTTCCTCTGATTTCAACTAATATTGTATGGCTCTATCTGGAAAACACCGCCATTGGAGAAGTTCCCTGCTGCATTGAGGATTTCACGAGGCTCCGTGTACTACTGATGTATTGTTGCCAGAGGTTGAAAAACATCTCCCCAAACATTTTCAGACTGAGAAGTCTAATGTTCGCCGACTTTACAGACTGTAGAGGTGTCATCAAGGCGTTGAGTGATGCAACTGTGGTAGCGACAATGGAAGATAGCGTTTCTTGTGTACCATTATCTGAAAACATTGAATATACATGTGAACGTTTCTGGGGTGAGTTGTATGGTGATGGTGATTGGGACTTAGGTACTGAATATTTTAGCTTCCGTAATTGCTTCAAATTGGATAGAGATGCGCGAGAGCTCATCCTACGATCATGCTTCAAGCCTGTGGCCTTACCAGGTGGAGAAATCCCTAAGTATTTCACGTATCGAGCTTATGGAGATTCCCTAACTGTCACTTTACCTCGGAGCTCTCTTTCTCAATCCTTCTTGCGATTTAAGGCTTGTCTCGTGGTTGACCCTCTCTCCGAGGGCAAGGGTTTTTATCGATATTTGGAGGTAAACTTTGGCTTCAATGGCAAACAGTATCAGAAATCATTTTTGGAAGATGAAGAACTGGAGTTTTGTAAGACGGATCATCTGTTTTTCTGTTCCTTCAAGTTCGAGTCTGAAATGACTTTCAACGATGTGGAGTTTAAGTTTTGTTGCTCCAATAGGATCAAAGAATGCGGTGTACGACTCATGTATGTCTCTCAAGAAACAGAGTACAACCAACAGACTACGAGAAGCAAGAAGCGGATGCGGATGACATCGGGAACATCTGAAGAATATATCAACTTAGCCGGTGACCAAATTGTAGCAGACACAGGATTGGCCGCTCTAAATATGGAGCTTTCGTTAGGGGAGGGAGAAGCATCATCATCAACATCTCTAGAGGGGGAAGCTTTGTCTGTTGATTATATGATAACTAAAGAACAAGATGAAGACATTCCTTTCTTGGATCCTGTTTCTGATGGTACATGGAGATCATTTTATTCTGCAGAATGA


Protein sequences

Name Description Sequence
RPP5 (RECOGNITION OF PERONOSPORA PARASITICA 5) RPP5 (RECOGNITION OF PERONOSPORA PARASITICA 5) [Arabidopsis thaliana].

MAASSSSGRRRYDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPNEAHMVEKISNDVSNKLITRSKCFDDFVGIEAHIEAIKSVLCLESKEARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCRSAFGKDSPPDDFKELAFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMMPRLRNGLNGDIMKTLRVSYDRLHQKDQDMFLCIACLFNGFEVSYVKDLLEDNVGLTMLSEKSLIRITPDGHIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIHEVVTEKTGTETLLGIRLPFEEYFSTRPLLIDKESFKGMRNLQYLKIGDWSDGGQPQSLVYLPLKLRLLDWDDCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMNLLCSKNLKEIPDLSNARNLEELDLEGCESLVTLPSSIQNAIKLRKLHCSGVILIDLKSLEGMCNLEYLSVDCSRVEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDSVSCVPLSENIEYTCERFWGELYGDGDWDLGTEYFSFRNCFKLDRDARELILRSCFKPVALPGGEIPKYFTYRAYGDSLTVTLPRSSLSQSFLRFKACLVVDPLSEGKGFYRYLEVNFGFNGKQYQKSFLEDEELEFCKTDHLFFCSFKFESEMTFNDVEFKFCCSNRIKECGVRLMYVSQETEYNQQTTRSKKRMRMTSGTSEEYINLAGDQIVADTGLAALNMELSLGEGEASSSTSLEGEALSVDYMITKEQDEDIPFLDPVSDGTWRSFYSAE

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAASSSSGRRRYDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANIAGE

Gene3D: G3DSA:3.40.50.10140
9-142 G3DSA:3.40.50.10140

RRRYDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRW

ProfileScan: PS50104
IPR000157
10-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RRYDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANI

HMMSmart: SM00255
IPR000157
11-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANI

HMMPfam: PF01582
IPR000157
14-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALT

HMMPanther: PTHR11017:SF20
37-1440 PTHR11017:SF20,SUBFAMILY NOT NAMED

GKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPNEAHMVEKISNDVSNKLITRSKCFDDFVGIEAHIEAIKSVLCLESKEARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCRSAFGKDSPPDDFKELAFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMMPRLRNGLNGDIMKTLRVSYDRLHQKDQDMFLCIACLFNGFEVSYVKDLLEDNVGLTMLSEKSLIRITPDGHIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIHEVVTEKTGTETLLGIRLPFEEYFSTRPLLIDKESFKGMRNLQYLKIGDWSDGGQPQSLVYLPLKLRLLDWDDCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMNLLCSKNLKEIPDLSNARNLEELDLEGCESLVTLPSSIQNAIKLRKLHCSGVILIDLKSLEGMCNLEYLSVDCSRVEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDSVSCVPLSENIEYTCERFWGELYGDGDWDLGTEYFSFRNCFKLDRDARELILRSCFKPVALPGGEIPKYFTYRAYGDSLTVTLPRSSLSQSFLRFKACLVVDPLSEGKGFYRYLEVNFGFNGKQYQKSFLEDEELEFCKTDHLFFCSFKFESEMTFNDVEFKFCCSNRIKECGVRLMYVSQETEYNQQTTRSKKRMRMTSGTSEEYINLAGDQIVADTGLAALNMELSLGEGEASSSTSLEGEALSVDYMITKEQDEDIPFLDPVSDG

HMMPanther: PTHR11017
37-1440 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKSINTFIDHGIERSRTIAPELISAIREARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPNEAHMVEKISNDVSNKLITRSKCFDDFVGIEAHIEAIKSVLCLESKEARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCRSAFGKDSPPDDFKELAFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMMPRLRNGLNGDIMKTLRVSYDRLHQKDQDMFLCIACLFNGFEVSYVKDLLEDNVGLTMLSEKSLIRITPDGHIEMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIHEVVTEKTGTETLLGIRLPFEEYFSTRPLLIDKESFKGMRNLQYLKIGDWSDGGQPQSLVYLPLKLRLLDWDDCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMNLLCSKNLKEIPDLSNARNLEELDLEGCESLVTLPSSIQNAIKLRKLHCSGVILIDLKSLEGMCNLEYLSVDCSRVEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDSVSCVPLSENIEYTCERFWGELYGDGDWDLGTEYFSFRNCFKLDRDARELILRSCFKPVALPGGEIPKYFTYRAYGDSLTVTLPRSSLSQSFLRFKACLVVDPLSEGKGFYRYLEVNFGFNGKQYQKSFLEDEELEFCKTDHLFFCSFKFESEMTFNDVEFKFCCSNRIKECGVRLMYVSQETEYNQQTTRSKKRMRMTSGTSEEYINLAGDQIVADTGLAALNMELSLGEGEASSSTSLEGEALSVDYMITKEQDEDIPFLDPVSDG

superfamily: SSF52540
65-435 SSF52540

ARISIVIFSKNYASSTWCLNELVEIHKCFNDLGQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCEVSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPNEAHMVEKISNDVSNKLITRSKCFDDFVGIEAHIEAIKSVLCLESKEARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCRSAFGKDSPPDDFKELAFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMMPRLRNGLNGDIMKTLRVSYDRLHQKDQDMFL

Gene3D: G3DSA:3.40.50.300
184-216 G3DSA:3.40.50.300

CFDDFVGIEAHIEAIKSVLCLESKEARMVGIWG

HMMPfam: PF00931
IPR002182
192-446 NB-ARC,NBS
NB-ARC

EAHIEAIKSVLCLESKEARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCRSAFGKDSPPDDFKELAFEVAKLAGHLPLGLNVLGSSLRRRGKKEWMEMMPRLRNGLNGDIMKTLRVSYDRLHQKDQDMFLCIACLFNGFEV

HMMSmart: SM00382
IPR003593
208-345 AAA,NBS
AAA+ ATPase domain

EARMVGIWGQSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPS

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

MVGIWGQSGIGKSTIG

Gene3D: G3DSA:3.40.50.300
217-355 G3DSA:3.40.50.300

QSGIGKSTIGRALFSQLSIQFPLRAFLTYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIEHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDRQFLKAHDIDLVYEVKLPSQGLALTMLCR

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLKHKKVLILLDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

AGHLPLGLNVLGSSL

superfamily: SSF52058
477-843 SSF52058,LRR

EMHNLLEKLGREIDRAKSKGNPGKRQFLTNFEDIHEVVTEKTGTETLLGIRLPFEEYFSTRPLLIDKESFKGMRNLQYLKIGDWSDGGQPQSLVYLPLKLRLLDWDDCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMNLLCSKNLKEIPDLSNARNLEELDLEGCESLVTLPSSIQNAIKLRKLHCSGVILIDLKSLEGMCNLEYLSVDCSRVEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFP

Gene3D: G3DSA:3.80.10.10
541-690 G3DSA:3.80.10.10

IDKESFKGMRNLQYLKIGDWSDGGQPQSLVYLPLKLRLLDWDDCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMNLLCSKNLKEIPDLSNARNLEELDLEGCESLVTLPSSIQNAIKLRKLHCSGVILIDLKSLEGMCNL

HMMPfam: PF07725
IPR011713
597-615 LRR_3
Leucine-rich repeat 3

YLVNLIMKYSKLEKLWEGT

HMMPfam: PF00560
IPR001611
643-664 LRR_1
Leucine-rich repeat

NLEELDLEGCESLVTLPSSIQN

Gene3D: G3DSA:3.80.10.10
691-844 G3DSA:3.80.10.10

EYLSVDCSRVEGTQGIVYFPSKLRLLLWNNCPLKRLHSNFKVEYLVKLRMENSDLEKLWDGTQPLGRLKQMFLRGSKYLKEIPDLSLAINLEEVDICKCESLVTFPSSMQNAIKLIYLDISDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPA

HMMPfam: PF07725
IPR011713
734-753 LRR_3
Leucine-rich repeat 3

YLVKLRMENSDLEKLWDGTQ

HMMPfam: PF00560
IPR001611
827-844 LRR_1
Leucine-rich repeat

SLEYLNLTGCPNLRNFPA

Gene3D: G3DSA:3.80.10.10
874-1156 G3DSA:3.80.10.10

AGLDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRG

superfamily: SSF52058
876-1196 SSF52058,LRR

LDYLDCLMRCMPCEFRPEYLVFLNVRCYKHEKLWEGIQSLGSLEEMDLSESENLTEIPDLSKATNLKHLYLNNCKSLVTLPSTIGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTAIEEILDLSKATKLESLILNNCKSLVTLPSTIGNLQNLRRLYMKRCTGLEVLPTDVNLSSLGILDLSGCSSLRTFPLISTNIVWLYLENTAIGEVPCCIEDFTRLRVLLMYCCQRLKNISPNIFRLRSLMFADFTDCRGVIKALSDATVVATMEDSVSCVPLSENIEYTCERFWGELYG

HMMPfam: PF07725
IPR011713
894-913 LRR_3
Leucine-rich repeat 3

YLVFLNVRCYKHEKLWEGIQ

HMMPfam: PF00560
IPR001611
940-962 LRR_1
Leucine-rich repeat

NLKHLYLNNCKSLVTLPSTIGNL

FPrintScan: PR00364
IPR000767
983-999 DISEASERSIST
Disease resistance protein

VNLSSLETLDLSGCSSL

HMMPfam: PF00560
IPR001611
987-1004 LRR_1
Leucine-rich repeat

SLETLDLSGCSSLRTFPL

Gene3D: G3DSA:3.40.50.300
1326-1388 G3DSA:3.40.50.300

MTFNDVEFKFCCSNRIKECGVRLMYVSQETEYNQQTTRSKKRMRMTSGTSEEYINLAGDQIVA


Diseases

Disease Pathogen Avirulence gene
Downy mildew




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox