PRGDB00000496 (Rps4)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Rps4
Gene Type Reference_R-Genes,_manually_curated
GenBank 18422530 (NM_123893)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPS4 (RESISTANT TO P. SYRINGAE 4) (RPS4) mRNA, complete cds.

DNA Sequence

ATGGAGACATCATCTATTTCCACTGTGGAAGACAAGCCACCGCAGCATCAGGTGTTCATCAATTTCCGTGGGGCAGATTTGCGCCGGAGATTCGTCAGCCATCTCGTAACGGCCTTGAAATTGAACAACATCAACGTCTTTATCGACGACTATGAAGACAGAGGTCAACCTCTAGATGTACTGCTGAAGAGGATAGAGGAGTCCAAAATCGTTTTGGCTATCTTCTCCGGCAACTACACCGAGTCAGTCTGGTGCGTGAGAGAGCTGGAGAAGATCAAAGATTGTACGGATGAAGGAACACTCGTTGCGATTCCAATCTTCTACAAGCTGGAGCCATCCACCGTTAGAGATTTGAAAGGAAAGTTCGGTGATAGATTTAGGAGTATGGCTAAGGGTGATGAGAGGAAAAAGAAATGGAAGGAAGCTTTTAACTTGATTCCTAACATTATGGGCATCATCATTGACAAGAAAAGTGTGGAGAGTGAGAAAGTCAATGAAATTGTGAAGGCGGTGAAGACAGCGTTGACCGGAATACCACCGGAGGGAAGTCACAACGCCGTCGTGGGTGCTTTAGGTAATAGCAACGCTGGAACTTCCTCAGGAGACAAAAAGCATGAGACTTTTGGAAACGAACAACGGTTAAAAGATTTGGAAGAGAAGTTGGATCGTGATAAATACAAGGGAACTCGTATCATTGGAGTTGTTGGGATGCCCGGAATTGGTAAAACCACACTCCTGAAAGAGCTATATAAGACGTGGCAGGGCAAGTTTTCGAGGCATGCGCTAATCGATCAAATCCGTGTAAAGTCCAAGCACTTGGAGTTGGATCGCTTGCCTCAAATGCTCTTAGGCGAGTTGTCCAAGTTAAACCATCCTCACGTAGACAATCTCAAAGATCCATACAGTCAACTGCATGAACGCAAAGTGCTTGTTGTACTTGATGATGTTAGTAAAAGGGAACAAATAGATGCTCTTCGTGAGATACTAGACTGGATTAAGGAGGGTAAGGAGGGAAGCAGGGTTGTCATTGCAACAAGCGACATGTCCTTAACAAATGGTTTGGTTGATGATACTTACATGGTTCAAAATTTGAACCACAGAGATAGCTTACAACTATTTCACTATCATGCCTTTATTGATGATCAAGCCAATCCTCAAAAGAAAGATTTCATGAAGCTGTCAGAAGGGTTTGTACATTACGCCAGAGGCCATCCACTAGCCCTCAAAGTATTGGGTGGAGAGCTTAATAAGAAAAGTATGGATCATTGGAATTCGAAAATGAAGAAACTTGCACAGAGCCCCAGCCCTAATATTGTCAGTGTCTTCCAAGTGAGTTATGATGAATTGACTACAGCGCAGAAAGATGCATTTCTCGACATAGCCTGTTTCAGATCACAGGACAAGGATTATGTAGAAAGTCTACTGGCTTCATCTGACCTTGGTTCGGCTGAAGCAATGAGTGCAGTCAAATCTCTCACGGATAAGTTCCTGATTAATACTTGTGATGGCCGAGTGGAGATGCATGATCTATTATATAAATTTTCAAGGGAAGTTGATCTGAAGGCATCTAATCAGGATGGTAGCAGACAACGGAGGCTGTGGCTCCATCAACACATAATCAAGGGAGGCATAATCAATGTATTGCAAAATAAAATGAAAGCTGCCAATGTTAGAGGTATTTTCCTAGACTTGTCTGAAGTGGAAGACGAAACGAGCTTAGACCGCGACCACTTCATAAATATGGGAAATCTCCGGTATCTCAAGTTCTACAATTCCCATTGTCCACAGGAATGTAAAACCAACAATAAAATCAACATCCCTGATAAACTTAAGCTACCATTGAAAGAAGTTCGATGCCTCCACTGGCTGAAATTCCCATTGGAGACACTTCCAAACGATTTCAACCCAATTAATCTTGTCGACCTTAAGCTGCCCTACAGTGAAATGGAACAACTTTGGGAGGGTGACAAGGACACACCATGCTTAAGGTGGGTCGATCTCAATCACTCAAGTAAGTTGTGCAGCTTGTCAGGGTTATCAAAAGCTGAAAAGCTTCAAAGGTTGAACCTTGAAGGTTGCACAACACTGAAAGCGTTTCCACATGATATGAAAAAAATGAAAATGCTTGCTTTCTTGAATCTGAAGGGGTGTACAAGTCTCGAATCTCTTCCAGAGATGAATTTGATTTCTCTGAAAACACTTACTCTCAGCGGCTGCTCAACTTTTAAGGAATTTCCGTTGATTTCAGATAATATAGAAACTCTATACTTAGATGGCACAGCAATAAGTCAGCTTCCTATGAACATGGAGAAGCTTCAGAGACTTGTTGTATTGAATATGAAAGACTGCAAAATGCTAGAGGAAATTCCAGGCCGTGTTGGTGAGCTGAAAGCTCTTCAAGAACTGATACTCTCTGATTGTTTAAATCTCAAGATTTTCCCAGAAATCGACATTAGCTTTTTAAACATTTTACTTTTGGATGGGACAGCCATTGAAGTGATGCCACAATTACCCTCAGTGCAGTATTTGTGCTTAAGCAGAAATGCTAAGATCAGCTGCCTTCCTGTTGGAATCAGTCAGCTTTCTCAACTTAAATGGCTGGACCTGAAGTATTGTACGAGTCTTACATCAGTTCCAGAGTTTCCACCAAATCTTCAGTGCTTAGATGCACACGGCTGTAGTTCGCTGAAGACAGTTTCAAAGCCTTTGGCCCGTATCATGCCAACTGAACAGAATCATTCCACATTCATTTTCACCAACTGTGAGAACCTGGAACAAGCTGCAAAGGAGGAAATCACATCGTATGCTCAAAGGAAATGCCAGCTGTTATCATATGCTCGGAAACGCTACAATGGGGGTCTTGTTTCAGAATCTTTGTTCAGCACTTGCTTTCCTGGATGTGAAGTGCCTTCTTGGTTTTGTCATGAAACAGTTGGATCTGAGTTAGAAGTAAAACTCCTCCCACATTGGCATGACAAGAAGCTTGCCGGGATTGCTCTATGTGCTGTAGTCTCATGTCTTGACCCCCAAGATCAAGTCAGCCGCTTGTCAGTGACCTGCACCTTTAAAGTAAAAGATGAAGACAAGTCTTGGGTCGCATATACTTGTCCAGTAGGAAGTTGGACCAGACATGGAGGCGGGAAAGATAAGATTGAGCTAGACCATGTCTTCATTGGATACACCAGTTGCCCACATACTATAAAATGTCATGAAGAAGGTAACTCAGATGAATGCAATCCTACCGAAGCCTCTCTTAAATTTACTGTGACAGGAGGTACAAGTGAGAATGGAAAATACAAGGTGTTGAAGTGTGGTTTAAGTTTGGTGTATGCTAAGGATAAAGACAAAAATAGTGCTCTTGAAACAAAGTACGATATGCTTATTGGAAAGAGCTTTCAAGAAACTTCAGAAGGGGTTGATGGAAGGGTAAAGAAAACGAAAGGAAAGTACGTTATGCCTGTTGAAAAGAACTTTCAAGAAACTACAGAAGGGGTTGATGGAAGAGTAAATAAAAAGAAAAAAACAAGAATGGATAATGGACGGCCAAAGAAGAAGCAGAGATCAGGAAGAGATGATAATCAAACTAGGATGCAAGTGGAACTCCAAGAAGGAAATATAAATTCAGTGATCATGCACACGGTTAAGAATTTCTGA


Protein sequences

Name Description Sequence
RPS4 (RESISTANT TO P. SYRINGAE 4) RPS4 (RESISTANT TO P. SYRINGAE 4) [Arabidopsis thaliana].

METSSISTVEDKPPQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRKCQLLSYARKRYNGGLVSESLFSTCFPGCEVPSWFCHETVGSELEVKLLPHWHDKKLAGIALCAVVSCLDPQDQVSRLSVTCTFKVKDEDKSWVAYTCPVGSWTRHGGGKDKIELDHVFIGYTSCPHTIKCHEEGNSDECNPTEASLKFTVTGGTSENGKYKVLKCGLSLVYAKDKDKNSALETKYDMLIGKSFQETSEGVDGRVKKTKGKYVMPVEKNFQETTEGVDGRVNKKKKTRMDNGRPKKKQRSGRDDNQTRMQVELQEGNINSVIMHTVKNF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSISTVEDKPPQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGI

Gene3D: G3DSA:3.40.50.10140
14-141 G3DSA:3.40.50.10140

PQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKE

ProfileScan: PS50104
IPR000157
14-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNI

HMMSmart: SM00255
IPR000157
15-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNI

HMMPfam: PF01582
IPR000157
18-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEA

HMMPanther: PTHR23155
25-939 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRK

HMMPanther: PTHR23155:SF48
25-939 PTHR23155:SF48,SUBFAMILY NOT NAMED

ADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRK

Gene3D: G3DSA:3.40.50.300
205-356 G3DSA:3.40.50.300

HETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVD

superfamily: SSF52540
205-438 SSF52540

HETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNI

HMMPfam: PF00931
IPR002182
211-472 NB-ARC,NBS
NB-ARC

EQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNHPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVE

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

IIGVVGMPGIGKTTLL

FPrintScan: PR00364
IPR000767
303-317 DISEASERSIST
Disease resistance protein

QLHERKVLVVLDDVS

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

ARGHPLALKVLGGEL

superfamily: SSF46785
436-540 SSF46785

PNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHII

superfamily: SSF52058
569-940 SSF52058,LRR

DETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRKC

Gene3D: G3DSA:3.80.10.10
619-810 G3DSA:3.80.10.10

CLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNL

HMMPfam: PF07725
IPR011713
638-657 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSEMEQLWEGDK

Gene3D: G3DSA:3.80.10.10
827-898 G3DSA:3.80.10.10

DGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKT

FPrintScan: PR00364
IPR000767
859-875 DISEASERSIST
Disease resistance protein

SQLSQLKWLDLKYCTSL


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Pseudomonas syringae PRGAV00000046




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox