PRGDB00035713 (LeEIX2)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
LeEIX2
Gene Type Reference_R-Genes,_manually_curated
GenBank 39577521 (AY359966)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 7
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum EIX receptor 2 (Eix2) gene, complete cds.

DNA Sequence

ATGGGCAAAAGAACTAATCCAAGACATTTCCTTGTTACTTGGTCTTTACTGCTCCTAGAGACAGCTTTTGGATTAACTTCAAGAGAAGTTAACAAGACCCTTTGTATAGAAAAGGAGAGAGGTGCCCTTCTTGAGTTTAAAAGAGGCCTTAACGACGATTTTGGTCGTTTATCTACCTGGGGTGATGAAGAAGAATGCTGCAATTGGAAGGGTATTGAATGTGACAAAAGAACAGGTCATGTTATTGTTCTTGATCTCCACAGTGAGGTTACTTGTCCAGGCCATGCTTGTTTTGCTCCAATATTGACAGGTAAAGTTAGTCCTTCTCTACTTGAGTTGGAGTATTTGAATTTCTTGGACCTCAGTGTTAATGGATTTGAAAATAGTGAGATACCAAGATTCATAGGCTCCCTTAAGAGACTGGAGTACTTAAACCTTTCATCTTCTGATTTTTCTGGTGAAATTCCAGCACAGTTCCAGAATCTAACTTCTTTGAGGATTCTTGATCTCGGAAACAATAATCTTATAGTAAAGGACCTTGTGTGGCTTTCTCATCTCTCCTCTCTAGAATTCTTGCGCCTTGGTGGTAACGATTTCCAAGCAAGAAACTGGTTTCGAGAGATAACTAAGGTCCCTTCATTGAAAGAATTGGACTTGAGTGTTTGTGGACTCTCTAAATTCGTTCCGTCTCCAGCTGATGTAGCTAATTCATCTTTGATCTCTCTTTCTGTTCTTCATTTATGTTGTAATGAGTTTTCTACTTCATCTGAATATAGCTGGTTATTCAATTTTAGCACAAGCCTAACTAGCATAGACCTTTCTCATAATCAACTCAGTCGTCAAATTGATGATCGCTTTGGGAGCTTGATGTATCTTGAACATCTTAATCTTGCTAATAATTTTGGGGCTGAAGGTGGGGTTCCAAGTTCTTTTGGGAATTTGACACGTCTACATTATCTGGACATGTCTAACACTCAGACATACCAATGGCTTCCTGAGTTGTTTCTCAGGTTATCAGGTAGTAGGAAATCACTTGAGGTTTTGGGATTGAACGACAACTCGTTGTTTGGTTCAATTGTTAATGTGCCAAGATTTTCATCCTTGAAGAAATTATACCTGCAGAAGAATATGCTGAATGGTTTTTTCATGGAAAGAGTGGGACAAGTTTCGAGCCTCGAGTATCTAGACTTGTCTGATAACCAAATGAGAGGGCCATTACCAGATTTAGCACTTTTTCCATCATTAAGAGAGTTGCATCTTGGCTCTAATCAATTTCAAGGGAGGATACCACAAGGTATTGGAAAACTTTCACAGCTTAGAATTTTTGACGTCTCGTCCAATAGATTAGAGGGTTTACCAGAAAGTATGGGGCAACTATCAAACCTGGAAAGGTTTGATGCTTCTTATAATGTCCTGAAGGGTACAATCACAGAGTCCCACTTTTCAAACCTCTCCAGTTTAGTAGACTTAGACCTATCCTTCAACTTGTTGTCTTTGAACACGAGATTCGATTGGGTTCCTCCTTTTCAACTACAATTTATAAGGCTTCCATCTTGCAATATGGGACCTTCTTTTCCGAAATGGCTACAAACTCAGAATAACTACACTCTTCTTGATATTTCTCTTGCGAATATATCAGACATGCTACCAAGTTGGTTCTCCAATCTTCCTCCCGAGCTCAAGATTCTGAATCTCTCTAACAACCACATCAGTGGCAGAGTTTCGGAGTTCATAGTGAGTAAACAAGATTACATGATTATAGATTTAAGTTCTAACAACTTTTCAGGACATTTGCCACTAGTTCCTGCCAATATACAGATCTTTTACCTTCATAAAAATCACTTCTCTGGATCCATTTCTTCCATTTGTAGAAATACAATAGGAGCTGCCACTTCCATCGACTTGTCACGCAACCAATTTTCAGGAGAAGTTCCTGATTGTTGGATGAATATGAGTAATCTAGCTGTTCTAAATCTAGCCTACAACAATTTCTCCGGAAAAGTTCCACAATCATTAGGCTCCTTGACAAATTTGGAGGCGTTATACATACGTCAGAACAGCTTTAGAGGAATGTTGCCTTCTTTTTCACAATGTCAGCTGCTGCAAATCTTGGATATTGGAGGGAATAAGTTGACTGGAAGAATCCCAGCATGGATAGGGACTGACCTACTCCAATTGCGCATTCTAAGCCTACGTTCCAACAAATTCGATGGCAGCATTCCATCACTTATCTGCCAGCTTCAATTTCTTCAGATACTGGACCTTTCAGAAAATGGATTATCTGGGAAAATTCCACAGTGCCTCAACAACTTTACCATATTGCGTCAAGAAAATGGCTCTGGTGAGTCAATGGATTTTAAAGTCCGTTATGACTATATTCCAGGATCTTACTTGTACATAGGTGATTTACTGATTCAATGGAAAAACCAGGAGTCCGAGTACAAGAATGCTTTACTATATCTGAAGATCATTGATCTTTCAAGTAATAAATTAGTTGGAGGTATCCCTAAAGAGATAGCTGAAATGAGAGGATTGAGATCATTGAACCTCTCGAGAAATGATCTTAATGGAACTGTCGTTGAAGGAATAGGTCAAATGAAGTTGTTGGAGTCCCTCGACTTGTCAAGAAACCAACTCTCTGGCATGATCCCTCAGGGCCTTTCTAACTTGACTTTTCTTAGTGTGTTGGACTTATCGAACAACCACTTATCAGGAAGAATTCCATCAAGCACTCAACTGCAGAGTTTCGATAGATCATCCTATAGTGGCAATGCTCAACTCTGCGGTCCTCCTCTTGAAGAGTGTCCTGGATATGCTCCCCCTATCGATCGTGGAAGCAACACCAATCCACAAGAACATGATGATGATGATGAGTTCTCATCTCTGGAGTTTTATGTATCAATGGTGCTAGGTTTCTTCGTCACGTTCTGGGGAATTTTAGGCTGTTTGATTGTCAACCGTTCGTGGAGGAATGCCTACTTCACATTCTTAACAGACATGAAGAGTTGGCTCCATATGACATCAAGAGTCTGCTTTGCAAGACTGAAGGGAAAGCTAAGGAACTGA


Protein sequences

Name Description Sequence
EIX receptor 2 EIX receptor 2 [Lycopersicon esculentum].

MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKVPSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFSTSLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLHYLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGSNQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKWLQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQDYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSFRGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPSLICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGSYLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNLSRNDLNGTVVEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNHLSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDDDDEFSSLEFYVSMVLGFFVTFWGILGCLIVNRSWRNAYFTFLTDMKSWLHMTSRVCFARLKGKLRN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-991 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKVPSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFSTSLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLHYLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGSNQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKWLQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQDYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSFRGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPSLICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGSYLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNLSRNDLNGTVVEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNHLSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDDDDEFSSLEFYVSMVLGFFVTFWGILGCLIVNRSWRN

HMMPanther: PTHR24420
1-991 PTHR24420,FAMILY NOT NAMED

MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKVPSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFSTSLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLHYLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGSNQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKWLQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQDYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSFRGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPSLICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGSYLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNLSRNDLNGTVVEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNHLSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDDDDEFSSLEFYVSMVLGFFVTFWGILGCLIVNRSWRN

superfamily: SSF52058
33-378 SSF52058,LRR

TLCIEKERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKVPSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFSTSLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLHYLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNML

Gene3D: G3DSA:3.80.10.10
35-329 G3DSA:3.80.10.10

CIEKERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKVPSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFSTSLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLHYLDMSNTQTYQ

HMMPfam: PF08263
IPR013210
38-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERGALLEFKRGLNDDFGRLSTWGDEEECCNWKGIECD

HMMPfam: PF13855
140-198 LRR_8,Leucine rich repeat

RLEYLNLSSSDFSGEIPAQFQNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGND

ProfileScan: PS51450
IPR001611
164-187 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRILDLGNNNLIVKDLVWLSHLS

HMMPfam: PF13504
212-225 LRR_7,Leucine rich repeat

PSLKELDLSVCGLS

ProfileScan: PS51450
IPR001611
213-234 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKELDLSVCGLSKFVPSPADV

ProfileScan: PS51450
IPR001611
241-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLHLCCNEFSTSSEYSWLF

ProfileScan: PS51450
IPR001611
267-289 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSIDLSHNQLSRQIDDRFGSL

HMMPfam: PF00560
IPR001611
267-289 LRR_1
Leucine-rich repeat

SLTSIDLSHNQLSRQIDDRFGSL

superfamily: SSF52047
306-625 SSF52047,LRR

GVPSSFGNLTRLHYLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGSNQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKWLQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQDYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRN

Gene3D: G3DSA:3.80.10.10
343-611 G3DSA:3.80.10.10

KSLEVLGLNDNSLFGSIVNVPRFSSLKKLYLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGSNQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKWLQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQDYMIIDLSSNNFSGHLPLVPANIQIFYLH

ProfileScan: PS51450
IPR001611
344-366 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLGLNDNSLFGSIVNVPRFS

HMMPfam: PF00560
IPR001611
391-408 LRR_1
Leucine-rich repeat

SLEYLDLSDNQMRGPLPD

ProfileScan: PS51450
IPR001611
391-413 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLDLSDNQMRGPLPDLALFP

ProfileScan: PS51450
IPR001611
414-437 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRELHLGSNQFQGRIPQGIGKLS

HMMPfam: PF13855
437-497 LRR_8,Leucine rich repeat

SQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGTITESHFSNLSSLVDLDLSFNLL

ProfileScan: PS51450
IPR001611
438-459 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRIFDVSSNRLEGLPESMGQL

ProfileScan: PS51450
IPR001611
486-507 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVDLDLSFNLLSLNTRFDWVP

ProfileScan: PS51450
IPR001611
559-581 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELKILNLSNNHISGRVSEFIVSK

Gene3D: G3DSA:3.80.10.10
612-776 G3DSA:3.80.10.10

KNHFSGSISSICRNTIGAATSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSFRGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPSLICQLQFLQILDLSENGLSGKIPQCLNNFTILRQ

HMMPfam: PF13855
631-687 LRR_8,Leucine rich repeat

TSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNS

superfamily: SSF52058
631-936 SSF52058,LRR

TSIDLSRNQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSFRGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPSLICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGSYLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNLSRNDLNGTVVEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNHLSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECP

ProfileScan: PS51450
IPR001611
653-676 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLAVLNLAYNNFSGKVPQSLGSLT

ProfileScan: PS51450
IPR001611
677-699 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEALYIRQNSFRGMLPSFSQCQ

ProfileScan: PS51450
IPR001611
700-722 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLQILDIGGNKLTGRIPAWIGTD

ProfileScan: PS51450
IPR001611
725-747 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRILSLRSNKFDGSIPSLICQL

ProfileScan: PS51450
IPR001611
749-771 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLQILDLSENGLSGKIPQCLNNF

HMMPfam: PF00560
IPR001611
750-768 LRR_1
Leucine-rich repeat

LQILDLSENGLSGKIPQCL

ProfileScan: PS51450
IPR001611
820-842 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLKIIDLSSNKLVGGIPKEIAEM

Gene3D: G3DSA:3.80.10.10
824-934 G3DSA:3.80.10.10

IDLSSNKLVGGIPKEIAEMRGLRSLNLSRNDLNGTVVEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNHLSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEE

ProfileScan: PS51450
IPR001611
844-867 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRSLNLSRNDLNGTVVEGIGQMK

ProfileScan: PS51450
IPR001611
868-891 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLESLDLSRNQLSGMIPQGLSNLT

FPrintScan: PR00019
869-882 LEURICHRPT,Leucine-rich repeat signature

LESLDLSRNQLSGM

HMMPfam: PF00560
IPR001611
869-890 LRR_1
Leucine-rich repeat

LESLDLSRNQLSGMIPQGLSNL

FPrintScan: PR00019
890-903 LEURICHRPT,Leucine-rich repeat signature

LTFLSVLDLSNNHL

ProfileScan: PS51450
IPR001611
892-914 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSVLDLSNNHLSGRIPSSTQLQ

HMMPfam: PF00560
IPR001611
893-910 LRR_1
Leucine-rich repeat

LSVLDLSNNHLSGRIPSS


Diseases

Disease Pathogen Avirulence gene
Eliciting Fungus Fungal ethylene-inducing xylanase

List of References

Mily Ron, Adi Avni
The receptor for the fungal elicitor ethylene-inducing xylanase is a member of a resistance-like gene family in tomato.
Plant Cell: 2004, 16(6);1604-15
PubMed:15155877 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox