PRGDB00035714 (Bs3)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Bs3
Gene Type Reference_R-Genes,_manually_curated
GenBank 158851516 (EU078684)
Gene Class Other
Domain Type NBS
Gene Species Capsicum annuum

Comment?

Capsicum annuum cultivar ECW-30R Bs3 (Bs3) gene, complete cds.

DNA Sequence

ATGATGAATCAGAATTGCTTTAATTCTTGTTCACCTCTAACTGTTGATGCACTTGAACCAAAAAAATCCTCTTGTGCTGCTAAATGCATACAAGTAAATGGTCCTCTTATTGTTGGAGCTGGCCCTTCAGGCCTGGCTACTGCTGCCGTCCTTAAGCAATACAGTGTTCCGTATGTAATCATTGAACGCGCGGACTGCATTGCTTCTCTGTGGCAACACAAGACCTACGATCGGCTTAGGCTTAACGTGCCACGACAATACTGCGAATTGCCTGGCTTGCCATTTCCACCAGACTTTCCAGAGTATCCAACCAAAAACCAATTCATCAGCTACCTCGTATCTTATGCAAAGCATTTCGAGATCAAACCACAACTCAACGAGTCAGTAAACTTAGCTGGATATGATGAGACATGTGGTTTATGGAAGGTGAAAACAGTTTCTGAAATCAATGGTTCAACCTCTGAATACATGTGTAAGTGGCTTATTGTGGCCACAGGAGAGAATGCTGAGATGATAGTGCCCGAATTCGAAGGATTGCAAGATTTTGGTGGCCAGGTTATTCATGCTTGTGAGTACAAGACTGGGGAATACTATACTGGAGAAAATGTGCTGGCGGTTGGCTGTGGCAATTCCGGGATCGATATCTCACTTGATCTTTCCCAACATAATGCAAATCCATTCATGGTAGTTCGAAGCTCGGTACAGGGTCGTAATTTCCCTGAGGAAATAAACATAGTTCCAGCAATCAAGAAATTTACTCAAGGAAAAGTAGAATTTGTTAATGGACAAATTCTAGAGATCGACTCTGTTATCTTGGCAACTGGTTATACCAGCAATGTAACTTCTTGGTTAATGGAGAGTGAATTGTTTTCAAGGGAGGGATGTCCAAAAAGCCCATTCCCAAATGGTTGGAAGGGGGAGGATGGTCTCTATGCAGTTGGATTTACAGGAATAGGACTGTTTGGTGCTTCTATAGATGCCACTAATGTTGCACAAGATATTGCCAAAATTTGGAAAGAACAAATGTAG


Protein sequences

Name Description Sequence
Bs3 Bs3 [Capsicum annuum].

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESELFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
1-342 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESELFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

HMMPanther: PTHR23023:SF5
1-342 PTHR23023:SF5,MONOOXYGENASE

MMNQNCFNSCSPLTVDALEPKKSSCAAKCIQVNGPLIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDSVILATGYTSNVTSWLMESELFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWKEQM

FPrintScan: PR00469
IPR000103
34-56 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPLIVGAGPSGLATAAVLKQYSV

FPrintScan: PR00368
IPR013027
35-54 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PLIVGAGPSGLATAAVLKQY

superfamily: SSF51905
36-242 SSF51905

LIVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEE

Gene3D: G3DSA:3.50.50.60
37-211 G3DSA:3.50.50.60

IVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNS

HMMPfam: PF00743
IPR020946
37-231 FMO-like
Flavin monooxygenase-like

IVGAGPSGLATAAVLKQYSVPYVIIERADCIASLWQHKTYDRLRLNVPRQYCELPGLPFPPDFPEYPTKNQFISYLVSYAKHFEIKPQLNESVNLAGYDETCGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVR

ProfileScan: PS01180
IPR000859
138-246 CUB
CUB

CGLWKVKTVSEINGSTSEYMCKWLIVATGENAEMIVPEFEGLQDFGGQVIHACEYKTGEYYTGENVLAVGCGNSGIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIV

FPrintScan: PR00368
IPR013027
158-176 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

CKWLIVATGENAEMIVPEF

FPrintScan: PR00469
IPR000103
198-222 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YTGENVLAVGCGNSGIDISLDLSQH

FPrintScan: PR00368
IPR013027
202-220 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

NVLAVGCGNSGIDISLDLS

Gene3D: G3DSA:3.40.50.720
IPR016040
212-269 NAD(P)-bd
NAD(P)-binding domain

GIDISLDLSQHNANPFMVVRSSVQGRNFPEEINIVPAIKKFTQGKVEFVNGQILEIDS

FPrintScan: PR00368
IPR013027
267-283 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

IDSVILATGYTSNVTSW

Gene3D: G3DSA:3.50.50.60
270-339 G3DSA:3.50.50.60

VILATGYTSNVTSWLMESELFSREGCPKSPFPNGWKGEDGLYAVGFTGIGLFGASIDATNVAQDIAKIWK


Diseases

Disease Pathogen Avirulence gene
Bacterial Spot Xanthomonas campestris pv. vesicatoria str. 85-10 PRGAV00000048

List of References

Patrick Römer, Simone Hahn, Tina Jordan, Tina Strauss, Ulla Bonas, Thomas Lahaye
Plant pathogen recognition mediated by promoter activation of the pepper Bs3 resistance gene.
Science: 2007, 318(5850);645-8
PubMed:17962564 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox