PRGDB00035718 (FLS2)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
FLS2
Gene Type Reference_R-Genes,_manually_curated
GenBank 42568348 (NM_124003)
Gene Class RLK
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana FLS2 (FLAGELLIN-SENSITIVE 2); ATP binding / kinase/ protein binding / protein serine/threonine kinase/ transmembrane receptor > (FLS2) mRNA, complete cds.

DNA Sequence

ATGAAGTTACTCTCAAAGACCTTTTTGATATTAACTCTCACCTTCTTCTTCTTTGGCATTGCACTAGCGAAACAGAGCTTTGAACCAGAGATCGAAGCTTTGAAATCCTTCAAGAATGGTATTTCCAACGACCCTTTAGGAGTATTATCAGATTGGACCATCATCGGTTCGTTACGACACTGTAATTGGACCGGAATCACCTGCGATAGTACCGGACATGTAGTCTCGGTTTCCTTGCTGGAGAAGCAACTTGAAGGTGTTCTGTCTCCAGCCATAGCGAATCTCACCTATCTCCAGGTTCTTGATCTCACTTCAAATAGTTTTACCGGCAAAATACCGGCTGAAATAGGAAAGTTAACCGAGCTTAACCAGCTTATTCTGTACCTAAACTATTTCTCTGGTTCGATTCCTTCTGGAATCTGGGAGCTTAAGAATATTTTCTATCTTGATCTTAGAAATAATTTGTTGTCCGGTGATGTTCCTGAGGAAATCTGCAAAACCAGTTCTTTGGTATTGATTGGGTTTGATTACAACAACTTAACCGGGAAAATACCAGAATGCTTAGGAGATTTGGTTCATCTCCAAATGTTTGTAGCAGCTGGTAACCATTTAACTGGTTCGATTCCGGTATCAATTGGTACTCTGGCTAATTTAACGGATTTAGACCTGAGTGGTAACCAGTTAACCGGAAAAATACCGAGAGATTTTGGAAATCTCTTGAACTTACAGTCTCTCGTTTTAACTGAAAACTTGTTGGAAGGAGATATACCAGCTGAGATCGGAAACTGCTCGAGCTTGGTCCAACTTGAGCTTTACGATAACCAGTTAACCGGGAAAATACCAGCTGAATTAGGGAATTTGGTTCAGCTGCAAGCACTCCGGATATACAAGAACAAACTTACTTCTTCAATTCCATCTTCATTGTTCCGGTTAACTCAGTTAACCCATTTGGGGTTATCAGAAAACCATTTGGTTGGACCGATATCAGAAGAAATCGGTTTTCTTGAGTCACTTGAAGTCCTCACACTTCATTCCAACAACTTCACAGGAGAGTTTCCACAGTCCATCACAAACTTGAGGAACTTGACAGTCCTAACGGTGGGGTTCAATAATATTTCCGGTGAGCTCCCGGCGGATCTAGGGCTTCTTACAAACCTTCGGAACCTTTCAGCGCACGACAATCTTCTTACCGGACCAATACCTTCCAGCATAAGTAACTGCACCGGTCTTAAACTCCTGGACCTGTCTCACAACCAAATGACTGGCGAGATCCCGCGGGGTTTCGGAAGGATGAATCTTACGTTCATTTCTATTGGGAGGAATCATTTCACCGGTGAAATTCCAGATGATATCTTCAACTGTTCAAACTTGGAAACTCTTAGTGTGGCAGATAACAACTTAACAGGAACTCTCAAGCCATTAATTGGGAAGCTTCAAAAACTCAGGATTTTGCAAGTTTCATATAACTCTCTCACTGGACCGATTCCTCGAGAAATCGGGAATCTGAAAGATTTGAATATCTTGTACCTTCACTCTAATGGTTTCACAGGGAGAATCCCGAGAGAGATGTCGAATCTCACTCTCCTCCAGGGGCTAAGGATGTATTCAAATGATCTTGAAGGTCCAATTCCTGAAGAAATGTTTGATATGAAGCTACTCTCAGTTCTTGATCTTTCCAACAACAAATTCTCAGGTCAAATTCCTGCCTTGTTCTCCAAGCTTGAATCGCTTACCTACTTGAGTCTTCAAGGAAACAAATTCAACGGGTCTATCCCTGCAAGCCTTAAGTCGCTTTCGCTTCTCAACACATTCGATATCTCCGACAATCTTCTCACTGGAACCATCCCTGGAGAGCTGTTAGCTTCTTTGAAAAACATGCAGCTTTACCTCAACTTCTCAAACAACTTGTTGACTGGAACCATCCCAAAGGAGCTTGGAAAGCTTGAAATGGTTCAAGAAATCGACCTTTCAAACAATCTCTTTTCTGGGTCTATTCCAAGATCTTTACAGGCCTGCAAAAATGTGTTCACACTGGATTTTTCGCAGAACAATCTCTCGGGTCATATACCAGATGAAGTCTTCCAAGGCATGGATATGATCATAAGCTTGAACCTTTCAAGGAACAGTTTCTCTGGAGAAATCCCTCAGAGCTTCGGGAACATGACGCATTTGGTCTCCTTGGATCTCTCTAGTAACAATCTCACTGGTGAAATTCCAGAGAGTCTCGCCAATCTTTCGACTCTGAAACATCTCAAACTAGCTTCAAACAACCTCAAAGGCCATGTTCCTGAATCCGGGGTGTTCAAAAACATCAACGCCTCTGATCTAATGGGAAACACAGATCTCTGTGGTAGCAAGAAGCCTCTCAAGCCATGTACGATCAAGCAGAAGTCGAGCCACTTCTCGAAGAGAACCAGAGTCATCCTGATTATTCTTGGATCAGCCGCGGCTCTTCTTCTTGTCCTGCTTCTTGTTCTGATTCTAACCTGTTGCAAGAAAAAAGAAAAAAAGATTGAAAATTCATCAGAGTCCTCATTACCGGATTTGGATTCAGCTCTGAAACTGAAGAGATTTGAACCAAAAGAGTTGGAGCAAGCAACAGATTCATTCAACAGTGCCAACATCATTGGCTCAAGCAGCTTAAGCACAGTGTACAAAGGTCAGCTAGAAGATGGGACAGTGATTGCAGTAAAAGTATTGAATCTAAAGGAATTCTCTGCAGAATCAGACAAGTGGTTCTACACAGAAGCTAAAACATTGAGCCAACTAAAACATCGAAACCTGGTGAAGATCTTAGGGTTTGCGTGGGAAAGCGGCAAAACGAAAGCTTTAGTGCTTCCATTTATGGAGAATGGAAACTTGGAGGACACCATTCACGGCTCTGCAGCACCGATTGGGTCGCTTTTAGAAAAAATCGATCTTTGTGTTCATATCGCAAGCGGAATCGATTATCTTCATTCTGGATATGGTTTTCCCATCGTTCATTGTGATCTGAAGCCAGCTAATATACTCCTTGACAGTGACCGCGTTGCTCACGTAAGCGATTTTGGAACTGCTCGGATTCTAGGTTTCCGCGAAGATGGAAGCACCACAGCTTCAACATCAGCCTTCGAGGGTACAATTGGATACTTAGCTCCAGAGTTTGCTTATATGAGGAAAGTGACAACAAAAGCCGATGTATTCAGCTTCGGGATCATAATGATGGAGCTGATGACGAAACAGAGACCAACTTCGTTGAATGATGAAGATTCACAAGACATGACTTTGCGCCAATTGGTGGAGAAATCGATTGGAAATGGAAGAAAAGGGATGGTTAGGGTTCTTGATATGGAACTCGGGGACTCTATTGTTTCTCTGAAACAGGAAGAGGCTATTGAAGACTTTCTGAAGCTTTGTTTGTTCTGTACAAGCTCTAGACCTGAAGATCGACCTGATATGAACGAGATTCTTACACATCTGATGAAACTTAGAGGCAAAGCGAATTCATTTCGAGAAGATCGTAACGAGGATCGAGAAGTTTAG


Protein sequences

Name Description Sequence
FLS2 (FLAGELLIN-SENSITIVE 2); ATP binding / kinase/ protein binding / protein serine/threonine kinase/ transmembrane receptor protein serine/threonine kinase FLS2 (FLAGELLIN-SENSITIVE 2); ATP binding / kinase/ protein binding / protein serine/threonine kinase/ transmembrane receptor protein serine/threonine kinase [Arabidopsis thaliana].

MKLLSKTFLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMKLRGKANSFREDRNEDREV

Domains

Domain Start-End Description Sequence

Seg: seg
3-18 seg

LLSKTFLILTLTFFFF

HMMPanther: PTHR24420:SF841
8-1157 SUBFAMILY NOT NAMED

FLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMKLR

HMMPanther: PTHR24420
8-1157 FAMILY NOT NAMED,FAMILY NOT NAMED

FLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMKLR

superfamily: SSF52058
24-302 L domain-like,LRR

KQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTS

HMMPfam: PF08263
IPR013210
30-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCD

Gene3D: G3DSA:3.80.10.10
30-299 no description

EIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNK

HMMSmart: SM00369
IPR003591
95-119 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTYLQVLDLTSNSFTGKIPAEIGKL

HMMPfam: PF00560
IPR001611
98-119 LRR_1
Leucine-rich repeat

LQVLDLTSNSFTGKIPAEIGKL

HMMSmart: SM00369
IPR003591
143-167 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNIFYLDLRNNLLSGDVPEEICKT

HMMSmart: SM00365
215-241 Leucine-rich repeat, SDS22-like subfamily

LANLTDLDLSGNQLTGKIPRDFGNLLN

HMMSmart: SM00369
IPR003591
215-238 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LANLTDLDLSGNQLTGKIPRDFGN

HMMPfam: PF13855
217-276 LRR_8,Leucine rich repeat

NLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQL

HMMSmart: SM00369
IPR003591
239-263 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLQSLVLTENLLEGDIPAEIGNC

HMMSmart: SM00369
IPR003591
287-311 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVQLQALRIYKNKLTSSIPSSLFRL

Gene3D: G3DSA:3.80.10.10
300-526 no description

LTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNL

superfamily: SSF52058
303-520 L domain-like,LRR

SIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIP

HMMSmart: SM00369
IPR003591
335-358 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LESLEVLTLHSNNFTGEFPQSITN

HMMSmart: SM00369
IPR003591
359-383 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLTVLTVGFNNISGELPADLGLL

HMMPfam: PF13516
359-380 LRR_6,Leucine Rich repeat

LRNLTVLTVGFNNISGELPADL

HMMSmart: SM00365
383-409 Leucine-rich repeat, SDS22-like subfamily

LTNLRNLSAHDNLLTGPIPSSISNCTG

HMMPfam: PF00560
IPR001611
410-430 LRR_1
Leucine-rich repeat

LKLLDLSHNQMTGEIPRGFGR

HMMSmart: SM00369
IPR003591
478-502 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQKLRILQVSYNSLTGPIPREIGNL

superfamily: SSF52058
525-784 L domain-like,LRR

NLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCG

Gene3D: G3DSA:3.80.10.10
527-784 no description

TLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCG

HMMPfam: PF13855
543-587 LRR_8,Leucine rich repeat

IPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKF

HMMSmart: SM00369
IPR003591
550-573 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKLLSVLDLSNNKFSGQIPALFSK

HMMSmart: SM00365
574-600 Leucine-rich repeat, SDS22-like subfamily

LESLTYLSLQGNKFNGSIPASLKSLSL

HMMSmart: SM00369
IPR003591
574-598 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LESLTYLSLQGNKFNGSIPASLKSL

HMMPfam: PF00560
IPR001611
652-672 LRR_1
Leucine-rich repeat

QEIDLSNNLFSGSIPRSLQAC

HMMSmart: SM00369
IPR003591
672-696 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

CKNVFTLDFSQNNLSGHIPDEVFQG

HMMPfam: PF00560
IPR001611
677-697 LRR_1
Leucine-rich repeat

TLDFSQNNLSGHIPDEVFQGM

HMMPfam: PF13855
702-758 LRR_8,Leucine rich repeat

SLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNL

HMMSmart: SM00365
721-747 Leucine-rich repeat, SDS22-like subfamily

MTHLVSLDLSSNNLTGEIPESLANLST

HMMSmart: SM00369
IPR003591
721-744 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTHLVSLDLSSNNLTGEIPESLAN

HMMSmart: SM00369
IPR003591
745-770 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSTLKHLKLASNNLKGHVPESGVFKN

Seg: seg
807-828 seg

VILIILGSAAALLLVLLLVLIL

Gene3D: G3DSA:3.30.200.20
820-925 no description

LVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKH

Seg: seg
832-845 seg

KKKEKKIENSSESS

superfamily: SSF56112
IPR011009
842-1153 Protein kinase-like (PK-like)
Protein kinase-like domain

SESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHL

HMMSmart: SM00220
IPR002290
870-1155 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMK

HMMSmart: SM00219
IPR020635
870-1153 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHL

ProfileScan: PS50011
IPR000719
870-1155 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMK

HMMPfam: PF00069
IPR000719
873-1152 Pkinase,Ser-thr
Protein kinase, catalytic domain

ANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTH

Gene3D: G3DSA:1.10.510.10
926-1155 no description

RNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMK

PatternScan: PS00108
IPR008271
993-1005 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDLKPANILL


Diseases

Disease Pathogen Avirulence gene
Eliciting Bacteria Bacteria with flagellum




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox