PRGDB00035725 (MLA10)

From PRG Wiki
Revision as of 22:31, 4 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
MLA10
Gene Type Reference_R-Genes,_manually_curated
GenBank 33943719 (AY266445)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare MLA10 (Mla10) mRNA, complete cds.

DNA Sequence

ATGGATATTGTCACCGGTGCCATTTCCAACCTGATTCCCAAGTTGGGGGAGCTACTCACGGAGGAGTTCAAGCTGCACAAGGGTGTCAAGAAAAATATTGAGGACCTCGGGAAGGAGCTTGATAGCATGAACGCTGCCCTCATCAAGATTGGTGAGGTGCCGAGGGAGCAGCTCGACAGCCAAGACAAGCTCTGGGCCGATGAGGTCAGAGAGCTCTCCTACGTCATTGAGGATGTCGTCGACAAGTTCCTCGTACAGGTTGATGGCATTAAGTCTGATGATAACAACAACAAATTTAAGGGGCTCATGAAGAGGACTACCGAGTTGTTGAAGAAAGTCAAGCATAAGCATGGGATAGCTCACGCGATCAAGGACATCCAAGAGCAACTCCAAAAGGTGGCTGATAGGCGTGACAGGAACAAGGTATTTGTTCCTCATCCTACGAGAACAATTGCTATTGACCCTTGCCTTCGAGCTTTGTATGCTGAAGCGACAGAGCTAGTTGGCATATATGGAAAGAGGGATCAAGGCCTCATGAGGTTGCTTTCCATGGAGGGCGATGATGCCTCTAATAAGAGACTGAAGAAGGTCTCCATTGTTGGATTTGGAGGGTTGGGCAAGACCACTCTTGCTAGAGCGGTATACGAGAAGATTAAAGGTGATTTCGATTGTCGGGCATTTGTTCCGGTCGGTCAGAACCCTGACATGAAGAAGGTTTTAAGGGATATCCTCATTGATCTCGGAAATCCTCACTCAGATCTTGCGATGCTGGATGCCAATCAGCTTATTAAAAAGCTTCATGAATTTCTAGAGAACAAAAGGTATCTTGTCATAATTGATGATATATGGGATGAAAAATTGTGGGAAGGCATCAACTTTGCTTTCTCCAATAGGAATAATCTAGGCAGTCGGCTAATCACCACAACCCGCATTGTCAGTGTCTCTAATTCATGTTGCTCATCAGATGGTGATTCTGTTTATCAAATGGAACCGCTTTCTGTTGATGACTCCAGAATGCTCTTCTACAAAAGAATATTTCCTGATGAGAATGCATGTATAAATGAATTTGAACAAGTATCCAGAGATATTCTAAAGAAATGTGGTGGGGTACCACTAGCCATAATTACTATAGCTAGTGCTTTGGCTGGTGACCAGAAGATGAAACCAAAATGTGAGTGGGATATTCTCCTTCGGTCCCTTGGCTCTGGACTAACAGAAGATAACAGTTTAGAGGAGATGCGGAGAATACTCTCTTTCAGCTATTCTAATCTACCTTCGAATCTGAAAACTTGTCTACTGTATCTATGTGTATATCCAGAAGATAGTATGATTTCTAGAGATAAACTGATATGGAAGTGGGTGGCCGAAGGATTTGTCCACCATGAAAATCAAGGAAATAGCCTGTATTTGCTCGGATTAAATTACTTCAACCAGCTCATTAATAGAAGTATGATCCAGCCAATATATAATTATAGCGGCGAGGCATATGCTTGCCGTGTACATGATATGGTTCTGGACCTTATCTGCAACTTGTCAAATGAAGCAAAGTTTGTGAATCTATTGGATGGCACTGGGAATAGCATGTCTTCACAGAGTAATTGTCGCCGTTTGTCCCTTCAGAAAAGAAATGAAGATCATCAAGCCAGGCCTTTCACAGATATCAAGAGTATGTCACGAGTGAGGTCAATTACTATCTTTCCATCTGCTATTGAAGTCATGCCATCTCTTTCAAGGTTTGACGTTTTACGTGTACTTGATCTGTCACGATGTAATCTTGGGGAGAATAGCAGCATGCAGCTTAACCTCAAGGGTGTTGGACATTTAACTCACCTAAGGTACCTTGGTCTAGAAGGTACCAACATCAGTAAGCTCCCTGCTGAGATAGGAAAACTGCAGTTTTTGGAGGTGTTGGATCTTGAAAACAATCATAATCTAAAGGAATTGCCGTCCACAGTTTGTAATTTCAGAAGATTAATCTACCTAAATTTAGTTGGCTGTCAGGTGGTTCCTCCAGTTGGTGTGTTGCAAAATCTGACATCCATAGAAGTGTTGAGTGGTATCTTGGTCTCTCTGAACATTATTGCACAAGAGCTTGGCAACTTGAAAAGGCTGAGGGAGCTTAACATTCTCTTCAATGATGGTAGTTTGGATTTTTATGAAGGTTTCGTGAAGTCTCTGTGCAACCTACATCACATCGAAAGTCTAATTTTTGATTGCAAATCCATAGAAACATCATCTTTTGAACTGATGGATCTTTTGGGAGAACGATGGATTCCTCCTGTACATCTCCGTGAATTTAAGTCATTCATGCCCAGCCAACTCTCTGCACTGCGAGGGTGGATACAGAGAGACCCCTCCCATCTCTCGAACCTCTCCGAGTTAACCCTCACATCAGTGAAGGAGGTGCAGCAGGATGACGTGGTAATCATTGGGGCCTTGTCGTCCCTTCGCCGTCTCTGCATAAGGAGCACCCACCAAACGCAACGGCTGCTAGTCATCCATGCAGATGGGTTCCGCTGTATTGTTTACTTTCAATTGGATTGTGGATCTGCCACGCAGATATTGTTTGAGCCTGGAGCTTTGCCGAGGGCGGAAGTAGTTGCGTTCAGCCTGGCCGTGCGGGTGGCAAAAGAGGATGGTAACTGTGGTTTCGACTTGGGCCTGCAGGGGAACCTGTTCTCCCTTCGACAGTTTGTCTCTGTTATTATCTATTGTGGTGGAGCGAGGGTTGGGGAGGCAAAGGAAGCGGAGGCTGCTGTGAGGCGTGCCCTCGACGCCCATCCCAACCATCCCCAGATTGCAATTTTCATGCACCCGCCTATAGCAGAAGGTGCTCAAGATGACGATTTAATGTGA


Protein sequences

Name Description Sequence
MLA10 MLA10 [Hordeum vulgare].

MDIVTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELDSMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDFYEGFVKSLCNLHHIESLIFDCKSIETSSFELMDLLGERWIPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLTSVKEVQQDDVVIIGALSSLRRLCIRSTHQTQRLLVIHADGFRCIVYFQLDCGSATQILFEPGALPRAEVVAFSLAVRVAKEDGNCGFDLGLQGNLFSLRQFVSVIIYCGGARVGEAKEAEAAVRRALDAHPNHPQIAIFMHPPIAEGAQDDDLM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF217
4-836 PTHR23155:SF217,OS11G0657900 PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELDSMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDFYEGFVKSLCNLHHIESLIFDCKSIETSSFELMDLLGERWIPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLTSVKEVQQDDVVIIGALSSLRRLCIRSTHQTQRLLVIHAD

HMMPanther: PTHR23155
4-836 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELDSMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDFYEGFVKSLCNLHHIESLIFDCKSIETSSFELMDLLGERWIPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLTSVKEVQQDDVVIIGALSSLRRLCIRSTHQTQRLLVIHAD

superfamily: SSF52540
150-407 SSF52540

TIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTED

Gene3D: G3DSA:3.40.50.300
191-287 G3DSA:3.40.50.300

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKL

HMMPfam: PF00931
IPR002182
191-463 NB-ARC,NBS
NB-ARC

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHEN

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

FLENKRYLVIIDDIW

Gene3D: G3DSA:3.80.10.10
288-293 G3DSA:3.80.10.10

WEGINF

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASAL

superfamily: SSF52047
519-827 SSF52047,LRR

NLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDFYEGFVKSLCNLHHIESLIFDCKSIETSSFELMDLLGERWIPPVHLREFKSFMPSQLSALRGWIQRDPSHLSNLSELTLTSVKEVQQDDVVIIGALSSLRRLCIRSTHQT

Gene3D: G3DSA:3.80.10.10
558-742 G3DSA:3.80.10.10

SRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDFYEGFVKSLCNLHHIESLIFDCKSI

HMMPfam: PF12799
609-643 LRR_4,Leucine Rich repeats (2 copies)

THLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNH

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

GKLQFLEVLDLENNHNL


Diseases

Disease Pathogen Avirulence gene
Powdery mildew (barley) Blumeria graminis PRGAV00000050




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox