PRGDB00044656 (P450)

From PRG Wiki
Jump to: navigation, search
P450
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 156152300 (EF567062)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cultivar Glenlea clone BAC 1648_464 disease resistance protein (Lr1) genomic region.

DNA Sequence

ATGGCGGCGGCTCTCGGCTCGGCGGCCACGCTCCTCGGCAAGGTGTTCACTATGCTGTCCGCCGCCCCGGTGGCGGCGTACGTGGACAGCCTGGAGCTCGGCCACAACTCCCAGCAGATCAGGGCCAAGCTCGCGCACACGCGAGGCCTGCTGCACAACGCCCAAGCCCAGGTGAGCGACGTCGGCCACAACCCTGGACTGCAGGAGCTGCTGCCGGCGCTGAGCAGGAACGCCGACGAGGCGGAGGATCTGCTGGATGAGCTCCACTACTTCCAGATCCATGACAGGCTCCACGCCACCAACTACGCCGCCACCCAGGCCAATTTTCTCCGTCATGCTCGCAATGCTCTCCGCCACACTGCCACCAGCAGCTGGGCCGCATGCTTTTCTTGTTCCTCTGCACAAGATGATAGTGATTCTACCAGTGGGGATGATGAGTTACGTTTCCACCGAGTGATCTTCTCCAGAAAATTCAAGTCGGTGTTACAGGACATGCAGACGCACTGTGATTCCGTCTCTGATTTGCTCGGCACTATCCCAACCAGCAGCATGCCAGTTGCTGTACACCGGCCGCAGATTGGATCCACAATTATACAAGATACATTGTATGGCAGGAGACACACTTTTGAGGAAACTGTCAACCGTATCTTCAGCTGCAAACACCCTGTTTCTGTTCTTCCTATAGTTGGTCCAGGGGGTATTGGAAAGACAACTTTTGCTCAACATCTGTATAATGATGCAAGGACTGAAGAGCACTTCCAAGTCAGGGTCTGGGTGTGTGTATCCACTGATTTCAATGTGCTTAAGCTCACCAGGGAGATCCTTGCCTGCATACCTGCAACTGAAGAAGGAGGAAGCAGCAGTGTTGCAAATGAAACAACCAATTTAGATCATCTTCAGAGATCCATTGTGCGCCGTCTCAAGTCCAAGAGGTTTCTAATTGTCTTGGACGATATATGGAAATGTGACAGTCAGGATCAGTGGAAAACCTTGTTAGCTCCCTTCACAAAGGGGGAAACCAAAGGAAGCATGCTACTTGTCACAACTCGATTTCCAAAGCTAGCACAAATGATGGAAACAATTGATCCACTAGAGCTGCTAGGTTTGGAGTCTAATGACTTCTTCACATTCTTTGAAGCATGTATATTTGGTGAAGACAACAAGCCAGAGCATTTCGAAGATGAGTTAGCTGGTATTGCACAAAAAATTGCAGACAAGCTAAAGGGTTCCCCGCTGGCAGCCAAAACAGTTGGTAGACTATTGCACAAGGACCTTTCTCAGAAACATTGGAATGGAGTTCTTGAAAAGCATCAGTGGCTAAAGCAGCAAAATAATGATGATATCATGCCATCTTTAAAAATTAGCTATGATTGCCTCCCTTTTGATCTGAAGAAATGTTTTTCCTATTGTGGCCTTTTCCCCGAAGATCATTGGTTTACTTCTTCAGAAATCAATCATTTCTGGGTTGCAGTAGGCATCATAGACTCTGATCACCAAGCCGATAGGAATTACCTGGAAGAGCTAGTGGACAATGGTTTTCTCATGAAGAAGAAAGAGTATTATTTGGATGATCGATGCAAACAAAAGGAATTTGATTGCTATGTAATGCATGATTTAATGCATGAGCTATCTAAGAGTGTTTCTGCACAAGAATGCCTCAATATAAGTGGCTTTGATTTCAGAGCTGATGCCATCCCGCAATCTGTTCGACACTTATCTATCAACATAGAAGACAGATATGATGCAAATTTTGAGGAAGAAATGTCTAAACTAAGGGAGAAGATAGACATTGCTAATGTGCGGACTTTGATGATTTTTAGAGAATATGAAGAAGAAAGAACCGCCAAGATATTGAAAGATAGCTTCAAGGAAATAAATAGTCTGCGTGTCCTATTTATAGTGGTGAAGTCTGCACAATCTTTTCCGGATATGTTTTCAAAACTTATCCACCTCCAGTACCTCAAAATTAGTTCACCTCACATTGACGGGGAAATGAGGTTACCTAGTACACTATCAAGATTTTATCACTTGAAATTCCTGGACCTAGATGATTGGCGTGGTAGTTCTGATTTGCCTGAAGACTTTAGCCACCTTGAGAATTTACATGATTTCCGTGCTGAAAGTAAACTCCACTCCAATATTCGCAATGTTGGAAAGATGAAGCATCTACAGAGGCTAGAAGAATTCCATGTTAAGAAGGAGAGCATGGGATTTGAACTGTCAGAACTTGGGCCATTGACAGAGCTTGAAGGAGGACTGACTGTACGTGGTCTTGAACACGTGGCAACCAAGGAGGAAGCTACTGCAGCCAAACTGATGTTGAAAAGGAATCTGAAGCAGTTGGAATTACTCTGGGACAGAGACCTTGGTGGACCAACTACAGATGCTGATATTCTTGATGCTCTTCAACCACACTCTAATCTTAGAGTACTTGCAATTGTAAATCATGGTGGTACCGTTGGTCCTAGCTGGTTGTGTCTTGACATCTGGTTAACAAGTTTAGAGACTCTCACTCTAGCAGGCGTATGTTGGAGCACTCTCCCGCCTTTTGCGAAGCTACCAAATCTCAAGGGACTCAAACTGATGAGAATTTCTGGAATGCATCAGTTTGGGTCTCTATGTGGTGGCACTCCAGGGAAATGTTTTATGCGCTTGAAGACAGTTGAGTTTTATGAGATGCCAGAACTTGCTGAATGGGTTGTGGAATCTAATTGCCATTCCTTTCCAAGTCTTGAAGAAATCAGATGCAGAAATTGTCCCAACCTCCGTGTGATGCCCTTCTCGGAGGTATCTTTCACCAATTTGCGCACACTTTTTGTTTCCAGGTGCCCCAAGATGTCTCTGCCCTCCATGCCTCACACCTCCACACTGACAGATCTGAATGTTGGAATAGGTGATTCAGAAGGGTTGCATTATGATGGAAAGAAATTGATTGTTATAGGGTATGGCGGTGCTTTGGCCTCCCACAATCTGGATACAGTAGAAGATATGATTGTCGAAAGATGCGACGGTTTGTTCCCTGAAGATTTGGATGGCAGTTTTGTCTTCCGTTCAGTTAAGAATCTCACATTACATGTATCTCGTCTTACCAGCAGCAAATCATCATCGTCAAAAGTGTTAAACTGTTTCCCAGCTCTTTCTGTGTTGGTGATAGTTGGCTATGAGGAATGTGTAATGCAGTTCCCATCATCCAGCTCACTGCAGAAACTTACCTTCTCAGGCTGCCGGGGCCTGGTTCTTGTGCCTGAGGAGAAGGAGAATGGAGGAGGAATTCAGGAGGACAACTCATTGCTCCAATCATTAACAATAGTGGGATGTGGCAAACTCTTCTCTCGTTGGCCCATGGGAATGGGAGAATCAGAGACCATTTGCCCTTTCCCTGCTTCCCTGAAGAAACTTGATGTTTTCCAAGAGCCAAGCATGAAGTCAATGGCTCTGCTCTCAAACCTCACGTCTCTCACCACTCTACAGCTAAACTACTGCAGTAATTTAACAGTGGATGGATTCAATCCTCTCATCGCAGTCAACCTCATAGAGCTGCAAGTGCATAGGTGCAACACCTTAGCAGCAGATATGCTCTCAGAGGCGGCCTCTCACTCTCAGAGGGCCAAATTATTGCCTGCAGGTTACATCTCTAGATTGGAGAAACTCAATGTGGATAACAACTGTGGATTGCTTGTTGCTCCTATTTGCAACCTCCTCGCCCCGGCCCTCCACACACTTGTATTCTGGATTGATGAAACGATGGAAAGCTTGACGGAAGAGCAAGAGAAAGCGCTGCAGCTCCTCACCTCCCTCCAGAATCTAACATTTTTCAGATGCAGGGGTCTACAGTCCCTTCCTCAAGGGTTGCATCGCCTTTCTTCTCTCAAGGAGTTATGTGTCCGTGGGTGTCTAAAAATCCAATCGTTGCCCAAGGAGGGCCTCCCGCTTTCGCTGAGAAGACTAAAGATGAATTGGCGCAGCGCTGAGATAAACGAGCAAATTGAGAAAATCAAAAGAAGCAACCCAGATTTATCCGTCTCGTATTGCTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Triticum aestivum].

MAAALGSAATLLGKVFTMLSAAPVAAYVDSLELGHNSQQIRAKLAHTRGLLHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNVGIGDSEGLHYDGKKLIVIGYGGALASHNLDTVEDMIVERCDGLFPEDLDGSFVFRSVKNLTLHVSRLTSSKSSSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIQEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPKEGLPLSLRRLKMNWRSAEINEQIEKIKRSNPDLSVSYC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
51-862 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

HMMPanther: PTHR11017:SF28
51-862 PTHR11017:SF28

LHNAQAQVSDVGHNPGLQELLPALSRNADEAEDLLDELHYFQIHDRLHATNYAATQANFLRHARNALRHTATSSWAACFSCSSAQDDSDSTSGDDELRFHRVIFSRKFKSVLQDMQTHCDSVSDLLGTIPTSSMPVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

superfamily: SSF52540
185-444 SSF52540

PVAVHRPQIGSTIIQDTLYGRRHTFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQN

HMMPfam: PF00931
IPR002182
208-498 NB-ARC,NBS
NB-ARC

TFEETVNRIFSCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRFPKLAQMMETIDPLELLGLESNDFFTFFEACIFGEDNKPEHFEDELAGIAQKIADKLKGSPLAAKTVGRLLHKDLSQKHWNGVLEKHQWLKQQNNDDIMPSLKISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDH

Gene3D: G3DSA:3.40.50.300
218-351 G3DSA:3.40.50.300

SCKHPVSVLPIVGPGGIGKTTFAQHLYNDARTEEHFQVRVWVCVSTDFNVLKLTREILACIPATEEGGSSSVANETTNLDHLQRSIVRRLKSKRFLIVLDDIWKCDSQDQWKTLLAPFTKGETKGSMLLVTTRF

FPrintScan: PR00364
IPR000767
225-240 DISEASERSIST
Disease resistance protein

VLPIVGPGGIGKTTFA

FPrintScan: PR00364
IPR000767
306-320 DISEASERSIST
Disease resistance protein

RLKSKRFLIVLDDIW

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

LKGSPLAAKTVGRLL

superfamily: SSF52058
535-962 SSF52058,LRR

VMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNV

Gene3D: G3DSA:3.80.10.10
618-735 G3DSA:3.80.10.10

LKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKES

Gene3D: G3DSA:3.80.10.10
797-948 G3DSA:3.80.10.10

DILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRNCPNLRVMPFSEVSFTNLRTLFVSRCPKMSL

FPrintScan: PR00364
IPR000767
930-946 DISEASERSIST
Disease resistance protein

VSFTNLRTLFVSRCPKM

superfamily: SSF52047
1035-1305 SSF52047,LRR

SSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIQEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLP

Gene3D: G3DSA:3.80.10.10
1056-1080 G3DSA:3.80.10.10

ECVMQFPSSSSLQKLTFSGCRGLVL

Gene3D: G3DSA:3.80.10.10
1095-1306 G3DSA:3.80.10.10

NSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSLTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPK


List of References

Sylvie Cloutier, Brent D McCallum, Caroline Loutre, Travis W Banks, Thomas Wicker, Catherine Feuillet, Beat Keller, Mark C Jordan
Leaf rust resistance gene Lr1, isolated from bread wheat (Triticum aestivum L.) is a member of the large psr567 gene family.
Plant Mol. Biol.: 2007, 65(1-2);93-106
PubMed:17611798 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox