PRGDB00045226 (At1g65850)

From PRG Wiki
Revision as of 15:37, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At1g65850
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108739384 (DQ527437)
Gene Class TNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Cvi-0 disease resistance protein (At1g65850) gene, partial cds.

DNA Sequence

CCTTAAGTGGATGTATTTGAATTATTCGAAAATCCTAAAGGAGCTACCTGATCTCTCAACAGCCACTAACCTTCAAGAACTATTTCTCGTTAAATGCTCAAGTTTGGTGGAGCTCCCATCCTCTATCGGAAAAGCCACTAATCTCCAGAAACTGTATCTTAATATGTGCACGAGTTTGGTGGAGCTGCCCTCTTCTATTGGGAACCTTCATAAGTTACAAAAATTGACTTTGAATGGATGCTCAAAGCTAGAGGTTCTTCCAGCTAACATCAACTTGGAATCTCTTGATGAACTTGATCTCACTGATTGCTTGGTGTTGAAAAGATTTCCTGAGATCTCTACAAACATTAAAGTTCTCAAGCTCTTAAGAACTACAATAAAAGAAGTCCCTTCGTCAATTAAGTCATGGCCTCGTCTTCGCGATTTGGAATTGTCATACAATCAAAACCTCAAAGGATTCATGCATGCTCTTGATATCATCACGACGATGTACTTTAACGATATAGAAATGCAAGAAATTCCTTTGTGGGTCAAGAAAATCTCTAGGCTTCAGACACTTATACTCAACGGATGTAAGAAGCTGGTATCACTCCCACAGCTTCCGGATTCCTTATC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LKWMYLNYSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLS


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-204 SSF52058,LRR

LKWMYLNYSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

Gene3D: G3DSA:3.80.10.10
6-203 G3DSA:3.80.10.10

LNYSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDS

HMMPanther: PTHR23155:SF298
20-204 PTHR23155:SF298

TATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

HMMPanther: PTHR23155
20-204 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

HMMPfam: PF00560
IPR001611
47-69 LRR_1
Leucine-rich repeat

NLQKLYLNMCTSLVELPSSIGNL

HMMPfam: PF13504
70-87 LRR_7,Leucine rich repeat

HKLQKLTLNGCSKLEVLP

HMMPfam: PF13504
137-151 LRR_7,Leucine rich repeat

PRLRDLELSYNQNLK

HMMPfam: PF13504
181-198 LRR_7,Leucine rich repeat

SRLQTLILNGCKKLVSLP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox