PRGDB00047104 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Revision as of 14:41, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145340317 (NM_117803)
Gene Class TN
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT4G16990) mRNA, complete cds.

DNA Sequence

ATGAAGTCTTCTTCTTCTCAGAGCTACGATGTTTTCCCCAACTTCAGAGGGGAAGATGTCCGCCACTCATTAGTCAGCCACCTTCGTAAGGAACTTGATCGCAAATTCATCAATACATTCAACGACAACAGGATCGAAAGAAGCCGCAAAATAACCCCAGAGCTGTTATTGGCTATAGAAAACTCAAGGATCTCACTTGTCGTCTTCTCTAAAAACTATGCTTCTTCCACGTGGTGCTTAGATGAATTGGTGAAGATCCAAGAGTGCTATGAGAAATTGGATCAAATGGTGATTCCTATTTTCTACAAAGTAGATCCTTCTCATGTTAGAAAACAGACCGGAGAGTTTGGCATGGTCTTTGGGGAGACCTGCAAGGGCAGAACAGAGAATGAGAAGCGAAAATGGATGCGAGCTCTAGCAGAGGTAGCACATCTAGCCGGAGAAGATCTTCGGAACTGGCGTAGCGAAGCAGAAATGCTTGAAAATATCGCCAAGGATGTTTCAAACAAACTCTTCCCCCCATCAAATAATTTCAGTGACTTCGTCGGGATTGAAGCTCATATAGAGGCATTGATATCAATGTTGCGCTTCGACTCCAAGAAAGCGCGAATGATAGGGATTTGTGGGCCTTCTGAAACTGGTAAGACTACTATAGGAAGAGCTTTATACAGCAGACTCAAAAGCGACTTCCACCATCGGGCTTTCGTAGCATATAAGAGAAAAATACGGAGCGACTATGACCAGAAGCTGTATTGGGAAGAACAATTTCTATCAGAAATTCTTTGTCAGAAGGATATAAAGATAGAGGAATGTGGTGCGGTGGAACAACGACTAAAGCACACGAAAGTTCTTATTGTTCTTGATGATGTTGATGATATAGAGCTACTAAAAACGTTGGTAGGACGTATCAGATGGTTTGGATCTGAGAGCAAAATTGTTGTGATTACTCAAAAAAGGGAACTTCTCAAGGCTCACAACATTGCACATGTTTATGAAGTGGGATTCCCATCAGAAGAACTGGCTCATCAAATGTTTTGTCGATATGCTTTTGGGAAAAACTCTCCACCTCATGGTTTCAACGAGCTTGCAGATGAAGCTGCAAAGATTGCCGGTAATCGTCCTAAAGCTCTCAAGTACGTTGGTTCGTCTTTTAGAAGACTAGACAAGGAACAATGGGTGAAGATGCTATCGGAGTTCCGTAGTAATGGGAATAAACTAAAAATCAGCTATGATGAGTTAGATGGTAAAGGTCAAGATTACGTTGCGTGTTTAACCAATGGTTCAAATTCCCAGGTGAAGGCAGAGTGGATCCACTTGGCACTAGGCGTGTCTATATTACTTAACATCCGCAGTGACGGAACGACAATTCTCAAACATTTGAGCTACAATCGAAGCATGGCGCAACAAGCAAAAATATGGTGGTATGAAAATTTGGAAAGAGTGTGCAAGAAGTACAATATATGTGGCATAGATAGCTCAACTGATGGTGGTGGTTCAACGTATGGACAATGTTCAAATTCCCAATTTCAAAGAAACATGGACGCAAGCCCCGGGGGAAACAAAACCAGTAATCAATCCACAAAAGATTCACCGAGAGCTTCTCAAGTAGAGAAGGAAAAGATCGAGTACTGTGAGCCACATGTATATATAACACCTGCCATCTTCAGTGACGGAACCAGAGCTCCCAAATACGTGGAGTCTAGCCGAAGAGTAACCCAAGTGCACCACGCCAAAACATGGTGGCCGGAGAATTGTGAAAAAGTGTACGAGAACCACAACAACATATATGGCATAGATAGATCAATTGACGGTGGTGATAAGTTTGAGGGAAAAAGTAAAGTTAGTGACGGTGGGTTAGACGGCAAAGATCAAGGTTCAATGTATGGACAAAGTTCAAATTCCGAGCTTCAAATAAACATGGACGCAGACAATAGGAGATGTGAACCTGTGAGTGAGATGCTTTTCAAAAATTACAATGTGTGTTCGCCTAATGGTAAGGGAAGTGATATTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MKSSSSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGEDLRNWRSEAEMLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDELDGKGQDYVACLTNGSNSQVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYNICGIDSSTDGGGSTYGQCSNSQFQRNMDASPGGNKTSNQSTKDSPRASQVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGKGSDI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGE

Gene3D: G3DSA:3.40.50.10140
5-143 G3DSA:3.40.50.10140

SSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVA

ProfileScan: PS50104
IPR000157
7-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHL

HMMSmart: SM00255
IPR000157
8-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHL

HMMPfam: PF01582
IPR000157
11-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALA

superfamily: SSF52540
62-396 SSF52540

SRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGEDLRNWRSEAEMLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKML

Gene3D: G3DSA:3.40.50.300
173-324 G3DSA:3.40.50.300

PPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKA

HMMPfam: PF00931
IPR002182
185-413 NB-ARC,NBS
NB-ARC

EAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDEL

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

MIGICGPSETGKTTIG

FPrintScan: PR00364
IPR000767
277-291 DISEASERSIST
Disease resistance protein

RLKHTKVLIVLDDVD

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

AGNRPKALKYVGSSF

HMMPfam: PF08381
IPR013591
431-486 BRX
Brevis radix-like domain

QVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

ProfileScan: PS51514
IPR013591
434-486 BRX
Brevis radix-like domain

AEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

HMMPfam: PF08381
IPR013591
535-593 BRX
Brevis radix-like domain

QVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENHN

HMMPanther: PTHR22870
536-659 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYN

HMMPanther: PTHR22870:SF61
536-659 PTHR22870:SF61,DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS)

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYN

ProfileScan: PS51514
IPR013591
538-593 BRX
Brevis radix-like domain

KEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENHN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox