PRGDB00047106 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Revision as of 14:41, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42563186 (NM_105944)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G72860) mRNA, complete cds.

DNA Sequence

ATGGCTTCATCTTCTTCATCTCCTATCTGGAAGTACGATGTGTTCTTGAGTTTCCGGGGAGAAGACACCCGCAAGAACATTGTCAGTCATTTGCACAAACAACTTGTCGATAAGGGAGTTGTTACGTTCAAAGATGATAAAAAGCTTGAGCTCGGCGACTCCATCTCCGAAGAAATCAGCAGAGCCATTCAAAACTCTACATATGCTCTTGTGATTCTATCGGAGAACTACGCTTCATCTAGTTGGTGCTTGGACGAGCTCCGCATGGTAATGGATCTTCACCTAAAGAATAAGATTAAAGTTGTCCCCATTTTCTATGGAGTTGATCCTTCTCACGTGAGACATCAGACTGGGAGTTTCACATTTGACAAGTACCAAGACTCTAAAATGCCTAACAAGGTCACAACTTGGAGAGAAGCTCTCACCCAGATCGCCAGTTTAGCAGGAAAGGATTTTGAAACTTGTGAAGACGAGGCGTCGATGATTGAAGAGATTGTTAAAGACATTTCAAAAAAGTTGTTGATTATGCAGCCAGTAGATTTCAGCGACATCGTAGGGATGAACGCTCACATGGAGCGCCTGAGTCCTCTATTGAGTATGGACTCTGAGAATGAGGTTCGTATGATAGGAATCTGGGGAATGGGAGGCATCGGCAAAACCACCATTGCCAAGTGTCTCTTTGACCAGTTTTCACAGGGATTTCCAGCTCGTTGTTTCCTTGAAAACGTTTCCAAGATTTATAGAAAGGGTGGTGTCTCGTCTTTAGCAGAAAAGTTTCTTTCAACTACACTTGGTCTGTCTAAGAAGAAGATGAAGGGTTCGGGCGTAAAACTTGGACCCCAGGAGATTAAGGCGAGGTTTGGATGTCGTAAAGTCTTTGTTGTCCTTGATAATGTGGATGACATGAGACAAATGCATGCTTTTGCTCAAGAGTCGAGCTGGTTTGGGCCAGGCAGTCGAATAATCATAACAACACGAGACAAGGGCTTGCTCAATACATACGGAGTAAGAACTGTATATGAAGTTAAGTGCATGGATAATGATGCTGCTCTTCAGTTATTTAACCAGTTGGCTTTCAAAGGAGCGCTTCCTCCTTCTGAACTTTATGAAAAACTGTCAATCCGAGCGTCTTGGCTTGCTCAAGGTCTTCCAGTCGCTATTGAAGCTTATGGATTATTTTTCCGAAGAATGACATCTTTAAAGGAGTGGGACGATGCATTATGTAGATTTATAGAAGCTCCTGATGAAAGTGTTATGGAGATCTTGAAAATTAGCTACGATGGATTAGAGGAAACAGATAAAAATGTATTCCTTCATGTAGCATGTCTCTTTAATGGAGAACCTCTCCGGCGTGCCACTACCCTTCTCGATGATGGTGTACTACAGGGTTGTCTGGGATTAAAAATATTGGCTGAGAAGTCTCTCATTGAAATAACAGCCAGTGGGTATATAAAGATGCATAATTTGGTAGACCAAACTGCAAGAGCAATTGTTAATCAAGAATCCATGCAGAGGCGCCATGGACGAGGAGTTTTGTGGAATCCTTATGAAATTTATGAATTACTGAAACGTAACACGACAAGCGAACCAACCAATTGCATGGCACTACATATGTGTGACATGGTTTATGCATTGCATCTGGGAGGGTATACAGCGTACCACGATACTCTCAAATTCCTCAAGATCTACAAGCACTCGAACCATATTAAGTCCAAGCTGCTTTTCAGTGGTGACGATACAAATCTACTTTCATCAAGGCTTAGGTTACTACATTGGGACGCATTTCCCTTGACAACCTTCCCTTGCCGATTCCAGCCGCAAGATCTTGTTGAAATCATTCTACATCGCAGCAATCTCACAAGCTTCTGGAAAGAAACCGTGGTAAAAGCTCTTAACAGATCTATGCTTATAACAATGTATCTTCTGGTACTTAACATTCTCGCAATTTTCCTATTCTTTGTTGAATATGCTCAGGGGATGCCAAACTTGAGAAGATTGGACTTGTCAGATTCTGAAAATCTGGAACAACTTCCAGATCTTTCAATGGCCGTTAATTTGGAGGAATTGATAACTCAAGGCTGCAAGAGGCTGAAGAAAATTCCAGAGTCCATCAGCTACCTTACTAGATTGACGACGCTTGATGTCTCATACTGTGAGGAGCTTGCTAGTTATATCACTATAAGGGAATTGAATAGGAGCGGCCGTCAAATTGCTTTGTATTTCTCGGGTAAAGAAGTGGAAACGAGGTCCATTGCAAATCTATCTATTGGAGGAAACATACATATTCAGATGTTTTGGCTTGATGGCAACGTAGATCATCTCAGTTTTACTACTGAGCAACAAGGACCTGATAAATTGACAAAGAAAGAGAAGCAACAAGCACCTGGTGAATTGACAAAGAGGGAGCAGCAACAAGAACCTCGTAAAAAAACAATATTATGTGGTTTTGGATCGCTTATGAGGAAAGGACGGAAAGTTAAGGCCACTTCAGAGTTTCTTGATCATGAATGGATGATGCAGAGGGATCAGCTAGCGCCTGATAACCAACAAGCTCTTGAATTTTCTACAAGGACACGGCAGGCACTTCAGTTCTTGCCAGAGTTTCATGGTCAGGAATCGGTGAAGAAAGCACAGGGAAAATCTCAACCCACATCCAAGTTCCATGGATTTACTTCAGTAGACATCAGCAGGTTCAGGTACAGCAGTGATGGTGCAAGTTTCCTCTGTTTTAGCCTTTCGATGTTCCCCTGCGTGAAAGAGTTAATTCTAATCAACCTAAACATTAAAGTGATCCCAGATGACGTGTGCGGCTTGAAATTCCTAGAGAAACTGGACTGGAGTGGCAATGATTTTGAGACTTTACCAGAAACCATGAATCAACTTCCCAGGTTGAAATATGCCAGCTTTCGTAACTGTTGCAGACTCAAAGCATTGCCAGCGCTGGTTCAGTTGGAGACAATCAAACTCTCTGGCTGTATAAACCTCCAATCATTGTTGGAACTTTCTTATGCTGAACAAGACTGTGGCAGATTCCAATGGCTTGAGCTTTGGGTTGATGGCTGCAAGAGCATTCGATCAATTTTAGATCAGCTTAGACATTTTATCAAGCTATCATATTTAGATCTTAGCAGCCATGAATTTGAGAAATTGCCATCCAGCATCGAAGTGCTTTCCTCTTTGAGAACTCTCTGCCTTAATAAGTGCAAGAAACTCAAATCGATTGAAGGGCTTCCGTTGTGCCTCAAGTCTCTCTACGCCCATGGCTGTGAAATCTTGGAAACTGTTTCCCTTCCTTTGAACCATTCTGTAAAACACCTTGATCTTAGTCATTGTTTCGGTTTAAAACGGGATGAACATCTGATCGCTCAGTTTCTCAACGAGGGAGAAAACGAAGAGGTATGTTTCCAGCTTATTCTTCCATTACTCCACTGCAAACAACCTGAACTTGATCATTCTCCATCTTTTTTTCTTTTCGTTGTTGTCCTCGAATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSPIWKYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASLAGKDFETCEDEASMIEEIVKDISKKLLIMQPVDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRTVYEVKCMDNDAALQLFNQLAFKGALPPSELYEKLSIRASWLAQGLPVAIEAYGLFFRRMTSLKEWDDALCRFIEAPDESVMEILKISYDGLEETDKNVFLHVACLFNGEPLRRATTLLDDGVLQGCLGLKILAEKSLIEITASGYIKMHNLVDQTARAIVNQESMQRRHGRGVLWNPYEIYELLKRNTTSEPTNCMALHMCDMVYALHLGGYTAYHDTLKFLKIYKHSNHIKSKLLFSGDDTNLLSSRLRLLHWDAFPLTTFPCRFQPQDLVEIILHRSNLTSFWKETVVKALNRSMLITMYLLVLNILAIFLFFVEYAQGMPNLRRLDLSDSENLEQLPDLSMAVNLEELITQGCKRLKKIPESISYLTRLTTLDVSYCEELASYITIRELNRSGRQIALYFSGKEVETRSIANLSIGGNIHIQMFWLDGNVDHLSFTTEQQGPDKLTKKEKQQAPGELTKREQQQEPRKKTILCGFGSLMRKGRKVKATSEFLDHEWMMQRDQLAPDNQQALEFSTRTRQALQFLPEFHGQESVKKAQGKSQPTSKFHGFTSVDISRFRYSSDGASFLCFSLSMFPCVKELILINLNIKVIPDDVCGLKFLEKLDWSGNDFETLPETMNQLPRLKYASFRNCCRLKALPALVQLETIKLSGCINLQSLLELSYAEQDCGRFQWLELWVDGCKSIRSILDQLRHFIKLSYLDLSSHEFEKLPSSIEVLSSLRTLCLNKCKKLKSIEGLPLCLKSLYAHGCEILETVSLPLNHSVKHLDLSHCFGLKRDEHLIAQFLNEGENEEVCFQLILPLLHCKQPELDHSPSFFLFVVVLE

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSPIWKYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASLAGK

ProfileScan: PS50104
IPR000157
10-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASL

Gene3D: G3DSA:3.40.50.10140
10-142 G3DSA:3.40.50.10140

WKYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALT

HMMSmart: SM00255
IPR000157
11-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASL

HMMPfam: PF01582
IPR000157
14-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALT

HMMPanther: PTHR23155
23-1140 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASLAGKDFETCEDEASMIEEIVKDISKKLLIMQPVDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRTVYEVKCMDNDAALQLFNQLAFKGALPPSELYEKLSIRASWLAQGLPVAIEAYGLFFRRMTSLKEWDDALCRFIEAPDESVMEILKISYDGLEETDKNVFLHVACLFNGEPLRRATTLLDDGVLQGCLGLKILAEKSLIEITASGYIKMHNLVDQTARAIVNQESMQRRHGRGVLWNPYEIYELLKRNTTSEPTNCMALHMCDMVYALHLGGYTAYHDTLKFLKIYKHSNHIKSKLLFSGDDTNLLSSRLRLLHWDAFPLTTFPCRFQPQDLVEIILHRSNLTSFWKETVVKALNRSMLITMYLLVLNILAIFLFFVEYAQGMPNLRRLDLSDSENLEQLPDLSMAVNLEELITQGCKRLKKIPESISYLTRLTTLDVSYCEELASYITIRELNRSGRQIALYFSGKEVETRSIANLSIGGNIHIQMFWLDGNVDHLSFTTEQQGPDKLTKKEKQQAPGELTKREQQQEPRKKTILCGFGSLMRKGRKVKATSEFLDHEWMMQRDQLAPDNQQALEFSTRTRQALQFLPEFHGQESVKKAQGKSQPTSKFHGFTSVDISRFRYSSDGASFLCFSLSMFPCVKELILINLNIKVIPDDVCGLKFLEKLDWSGNDFETLPETMNQLPRLKYASFRNCCRLKALPALVQLETIKLSGCINLQSLLELSYAEQDCGRFQWLELWVDGCKSIRSILDQLRHFIKLSYLDLSSHEFEKLPSSIEVLSSLRTLCLNKCKKLKSIEGLPLCLKSLYAHGCEILETVSLPLNHSVKHLDLSHCFGLKRDEHLIAQFLNEGENEEVCFQLILP

HMMPanther: PTHR23155:SF344
23-1140 PTHR23155:SF344

TRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYALVILSENYASSSWCLDELRMVMDLHLKNKIKVVPIFYGVDPSHVRHQTGSFTFDKYQDSKMPNKVTTWREALTQIASLAGKDFETCEDEASMIEEIVKDISKKLLIMQPVDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRTVYEVKCMDNDAALQLFNQLAFKGALPPSELYEKLSIRASWLAQGLPVAIEAYGLFFRRMTSLKEWDDALCRFIEAPDESVMEILKISYDGLEETDKNVFLHVACLFNGEPLRRATTLLDDGVLQGCLGLKILAEKSLIEITASGYIKMHNLVDQTARAIVNQESMQRRHGRGVLWNPYEIYELLKRNTTSEPTNCMALHMCDMVYALHLGGYTAYHDTLKFLKIYKHSNHIKSKLLFSGDDTNLLSSRLRLLHWDAFPLTTFPCRFQPQDLVEIILHRSNLTSFWKETVVKALNRSMLITMYLLVLNILAIFLFFVEYAQGMPNLRRLDLSDSENLEQLPDLSMAVNLEELITQGCKRLKKIPESISYLTRLTTLDVSYCEELASYITIRELNRSGRQIALYFSGKEVETRSIANLSIGGNIHIQMFWLDGNVDHLSFTTEQQGPDKLTKKEKQQAPGELTKREQQQEPRKKTILCGFGSLMRKGRKVKATSEFLDHEWMMQRDQLAPDNQQALEFSTRTRQALQFLPEFHGQESVKKAQGKSQPTSKFHGFTSVDISRFRYSSDGASFLCFSLSMFPCVKELILINLNIKVIPDDVCGLKFLEKLDWSGNDFETLPETMNQLPRLKYASFRNCCRLKALPALVQLETIKLSGCINLQSLLELSYAEQDCGRFQWLELWVDGCKSIRSILDQLRHFIKLSYLDLSSHEFEKLPSSIEVLSSLRTLCLNKCKKLKSIEGLPLCLKSLYAHGCEILETVSLPLNHSVKHLDLSHCFGLKRDEHLIAQFLNEGENEEVCFQLILP

superfamily: SSF52540
167-418 SSF52540

KDISKKLLIMQPVDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRTVYEVKCMDNDAALQLFNQLAFKGALPPSELYEKLSIRASWLAQGLPVAIEAYGLFFRRMTSLKEWDDALCRFIEAPDESV

Gene3D: G3DSA:3.40.50.300
177-304 G3DSA:3.40.50.300

QPVDFSDIVGMNAHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQ

HMMPfam: PF00931
IPR002182
189-450 NB-ARC,NBS
NB-ARC

AHMERLSPLLSMDSENEVRMIGIWGMGGIGKTTIAKCLFDQFSQGFPARCFLENVSKIYRKGGVSSLAEKFLSTTLGLSKKKMKGSGVKLGPQEIKARFGCRKVFVVLDNVDDMRQMHAFAQESSWFGPGSRIIITTRDKGLLNTYGVRTVYEVKCMDNDAALQLFNQLAFKGALPPSELYEKLSIRASWLAQGLPVAIEAYGLFFRRMTSLKEWDDALCRFIEAPDESVMEILKISYDGLEETDKNVFLHVACLFNGEPLR

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

MIGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RFGCRKVFVVLDNVD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AQGLPVAIEAYGLFF

superfamily: SSF46785
416-523 SSF46785

ESVMEILKISYDGLEETDKNVFLHVACLFNGEPLRRATTLLDDGVLQGCLGLKILAEKSLIEITASGYIKMHNLVDQTARAIVNQESMQRRHGRGVLWNPYEIYELLK

superfamily: SSF52058
485-1111 SSF52058,LRR

KMHNLVDQTARAIVNQESMQRRHGRGVLWNPYEIYELLKRNTTSEPTNCMALHMCDMVYALHLGGYTAYHDTLKFLKIYKHSNHIKSKLLFSGDDTNLLSSRLRLLHWDAFPLTTFPCRFQPQDLVEIILHRSNLTSFWKETVVKALNRSMLITMYLLVLNILAIFLFFVEYAQGMPNLRRLDLSDSENLEQLPDLSMAVNLEELITQGCKRLKKIPESISYLTRLTTLDVSYCEELASYITIRELNRSGRQIALYFSGKEVETRSIANLSIGGNIHIQMFWLDGNVDHLSFTTEQQGPDKLTKKEKQQAPGELTKREQQQEPRKKTILCGFGSLMRKGRKVKATSEFLDHEWMMQRDQLAPDNQQALEFSTRTRQALQFLPEFHGQESVKKAQGKSQPTSKFHGFTSVDISRFRYSSDGASFLCFSLSMFPCVKELILINLNIKVIPDDVCGLKFLEKLDWSGNDFETLPETMNQLPRLKYASFRNCCRLKALPALVQLETIKLSGCINLQSLLELSYAEQDCGRFQWLELWVDGCKSIRSILDQLRHFIKLSYLDLSSHEFEKLPSSIEVLSSLRTLCLNKCKKLKSIEGLPLCLKSLYAHGCEILETVSLPLNHSVKHLDLSHC

Gene3D: G3DSA:3.80.10.10
592-628 G3DSA:3.80.10.10

WDAFPLTTFPCRFQPQDLVEIILHRSNLTSFWKETVV

FPrintScan: PR00364
IPR000767
658-674 DISEASERSIST
Disease resistance protein

QGMPNLRRLDLSDSENL

Gene3D: G3DSA:3.80.10.10
661-723 G3DSA:3.80.10.10

PNLRRLDLSDSENLEQLPDLSMAVNLEELITQGCKRLKKIPESISYLTRLTTLDVSYCEELAS

Gene3D: G3DSA:3.80.10.10
906-1029 G3DSA:3.80.10.10

SFLCFSLSMFPCVKELILINLNIKVIPDDVCGLKFLEKLDWSGNDFETLPETMNQLPRLKYASFRNCCRLKALPALVQLETIKLSGCINLQSLLELSYAEQDCGRFQWLELWVDGCKSIRSILD

Gene3D: G3DSA:3.80.10.10
1030-1111 G3DSA:3.80.10.10

QLRHFIKLSYLDLSSHEFEKLPSSIEVLSSLRTLCLNKCKKLKSIEGLPLCLKSLYAHGCEILETVSLPLNHSVKHLDLSHC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox