PRGDB00047139 (TIR-NBS class disease resistance protein)

From PRG Wiki
Revision as of 14:41, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
TIR-NBS class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121544147 (EF157841)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species (Populus tomentosa x P. bolleana) x P. tomentosa

Comment?

(Populus tomentosa x P. bolleana) x P. tomentosa TIR-NBS class disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCAGAACCAGAGTCTTCTCGTTCTATACCAGAAGGGGACTATGATGTCTTCTTGAGCTTTAGAGGAGAAGATACTCGCAAGACGTTTACTGGTCATCTATATGCTGCCTTAGATGATGCAGGAATCCGCACTTTTCTAGATGATAATGAACTTCCTAGAGGAGAAGAAATCTCCGAGCATCTTCTCAAGGCAATTCGAGAATCAAAGATATCCATAGTTGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTAGAGATTCTAAAGTGCAAAAGGAAGAAAACCGGTCAGATTGTTCTTCCTATATTCTATGACATTGATCCTTCAGATGTGAGAAAACAGACTGGCTGTTTTGCAGAGGCATTTGATAAGCATGAAGAGTGTTTTGAAGAGAAGTTGGTGAAGGAGTGGAGAAAAGCTCTTGAGGATGCCGGAAACCTATCTGGATGGAATCTCAATGATATGGCAAATGGGCATGAAGCAAAATCTATCAAAGGGATTATCAAGGATGTGGTGAATAAATTAGAACCCAAGTACTTATATGTTCCTGAGCACCTGGTAGGTATGGATCTTGCTCACGATATTTATGACTTTCTAAGTACTGCAACAGATGATGTACGCATTGTGGGCATACATGGGATGTCAGGAATAGGAAAGACGACTCTAGCAAAAGTTGTATTTAATCAACTCTGCAATGGATTCGAGGGAAGCTGTTTTCTTTCGGATATCAATGAAACATCAAAACAATTCAATGGTCTGGCTGGTTTACAAAAGCAACTTCTTCGTGATATTTTAAAACAAGATGTTGCAAACTTCGATTGTGTCGATAGAGGAAAGGTTCTGATCAAAGAGCGAATTCGTCGCAAAAGAGTTCTTGTTGTTGCTGATGATGTGGCTCATCCGGAACAGCTGAATGCATTGATGGGAGAGCGAAGTTGGTTTGGTCCCGGAAGTAGAGTAATTATTACAACAAGAGATTCAAATCTTCTTCGTGAAGCAGATCAAACATATCAGATCAAAGAATTGAAACCAGGCGAGTCCCTTCAGCTTTTCAGCAGGCATGCCTTTAAGGACTCCAAGCCAGCAAAAGATTATATTGAACTTTCAAAGAAAGCCGTTGATTACTGTGGAGGACTTCCTTTAGCTCTTCAGGTTATAGGAGCTCTTCTGTACAGGAAAAACAGAGGTGAATGGGAACGTGAAATTGACAACTTGAGCAGAATTCCAAACCAAGATATTCAAGGAAAGCTTCTAATAAGTTATGACGCACTTGATGGTGAACTACAAAGAGCATTCCTTGATATTGCATGCTTCTTTATTGGTATAGAGAGAGAATACGTCGCAAAAGTGCTAGGAGTCCGTTGCCGTCCCAATCCAGAAGTTGTTTTGGAAACTCTCAGTGAAAGGTCTCTGATTCAATTTAATGCCTTTGGAAAGATAACCATGCATGATCTATTACGAGACATGGGAAGGGAGATCGTTCGTGAATCGTCTCCAAAAGAACCTGGATAG


Protein sequences

Name Description Sequence
TIR-NBS class disease resistance protein TIR-NBS class disease resistance protein [(Populus tomentosa x P. bolleana) x P. tomentosa].

MAEPESSRSIPEGDYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNLSGWNLNDMANGHEAKSIKGIIKDVVNKLEPKYLYVPEHLVGMDLAHDIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQGKLLISYDALDGELQRAFLDIACFFIGIEREYVAKVLGVRCRPNPEVVLETLSERSLIQFNAFGKITMHDLLRDMGREIVRESSPKEPG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EPESSRSIPEGDYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNLSGW

ProfileScan: PS50104
IPR000157
13-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GDYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNL

Gene3D: G3DSA:3.40.50.10140
14-146 G3DSA:3.40.50.10140

DYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKA

HMMSmart: SM00255
IPR000157
14-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNL

HMMPfam: PF01582
IPR000157
17-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALE

HMMPanther: PTHR11017
40-509 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNLSGWNLNDMANGHEAKSIKGIIKDVVNKLEPKYLYVPEHLVGMDLAHDIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQGKLLISYDALDGELQRAFLDIACFFIGIEREYVAKVLGVRCRPNPEVVLETLSERSLIQFNAFGKITMHDLLRDMGREIVRESSPKEPG

HMMPanther: PTHR11017:SF20
40-509 PTHR11017:SF20,SUBFAMILY NOT NAMED

DAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECFEEKLVKEWRKALEDAGNLSGWNLNDMANGHEAKSIKGIIKDVVNKLEPKYLYVPEHLVGMDLAHDIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQGKLLISYDALDGELQRAFLDIACFFIGIEREYVAKVLGVRCRPNPEVVLETLSERSLIQFNAFGKITMHDLLRDMGREIVRESSPKEPG

superfamily: SSF52540
175-419 SSF52540

KDVVNKLEPKYLYVPEHLVGMDLAHDIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDI

Gene3D: G3DSA:3.40.50.300
182-339 G3DSA:3.40.50.300

EPKYLYVPEHLVGMDLAHDIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREA

HMMPfam: PF00931
IPR002182
200-449 NB-ARC,NBS
NB-ARC

DIYDFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGLQKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGPGSRVIITTRDSNLLREADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQGKLLISYDALDGELQRAFLDIACFFIGIE

FPrintScan: PR00364
IPR000767
214-229 DISEASERSIST
Disease resistance protein

IVGIHGMSGIGKTTLA

FPrintScan: PR00364
IPR000767
291-305 DISEASERSIST
Disease resistance protein

RIRRKRVLVVADDVA

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

CGGLPLALQVIGALL

superfamily: SSF46785
417-504 SSF46785

QDIQGKLLISYDALDGELQRAFLDIACFFIGIEREYVAKVLGVRCRPNPEVVLETLSERSLIQFNAFGKITMHDLLRDMGREIVRESS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox