PRGDB00047154 (OSJNBa0065C16.23)

From PRG Wiki
Revision as of 14:42, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
OSJNBa0065C16.23
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 14277245 (AC074354)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0065C16, from Chromosome 10, complete sequence.

DNA Sequence

ATGGCTTATGAGATTGAGGACTGGATTGATGAGGCCATGCATCATCTCACTAAGGACGACAGCAATTCTGGGTTCATTTCGAAGATCATTTTTCGTCTCAACAGGATGAGAACACAAAATCGCATGGCCAATCAAATAAATGAGGTGAAAACACGTGTGGTGGAGATGAGCCATCGGCACAAAAGGTATAAGCTTGATGCAAGTATCTCTACATCTGACTATACAGCCATTGATCCTCGCCTCTGTGCGCTATATGCGGATGCAGAGGCCCTTGTGGGTATGGATGGTCCAAGGGATGAGATTACCAAATGGTTTATGGGTGCAGATCAACAGTTGATGGTGGTGTCTGTTTTGGGAATTGGTGGTCTAGGCAAGACAGCACTTGCTAACGAAGTGTACAAAAAGATTGGAGGGCAATTTGATTGTCATGCATTTATCTCCATCTCTCAGAAACCAGATATAATGTGCCCTCCCCAAAATAATCATGCTAGCAGAGTGATAACAACAACACGGATTGAAAAGGTGGCTATGGAATGTTGCAGCTATCGCTGTGAATTTATTTATAAGATGAAACCACTGAATGAACATGATTCAAGAAGACTATTTTTTAATAGAATATTTGGCTCGGAGAATGCCTGTCCAGAACGATTTAAGGGAGTTTCAACTGGAATTTTACAAAGATGCGGTGGTCTGCCACTTGCAATTGTTAGTGTCTCTAGCCTGTTAGCTAATCCAGCAACCTCTGTAGATAGACAATGGGAGTACGTAAGCAATTCTTTGAGTGATAAGTTTGGAATAATGCCTGCATTGGATGGAATGAGAAACATTTTACATCTTAGTTACAAAAACCTTCCTTATCATCTCAAGACATGTTTTCTTTATCTTGGCATTTATCCAGAGGACTACATAATAAGGAAAAGTGATGTGGTCAGGCAATGGATAACTGAAGGTTTTGTTCATAAAGCCCAGGTACAAGATGCAGAAGATGTTGCAGGTAGCTACTTCAACGAGCTAGTCAACAGGAGCATGATTCTACCCACAGACATAGACTATCAGAATAATGTAGTATCCTGTAAGCTACATGATATGATGCTTGATCTTATCTTGTATGAGGCAGCAGAAGAGAGATTTTTTACAGTAACAGATAATTTCAGTACATTGCTGGGCCTGCACAATAGTGTCCATCGGCTCTCCCTCCAATATGACAACGGAAACCATGACACCGCAGCAGCAACTACTAGTCTAACATATCTTCGGTCGCTTGCAATCTTTGGAAATTCTAAATACATGCACATGCATCATCTTTCAGACTTTAAGTTTCTCCGAGTTTTAATTACAGTGTTTTCAGATGCTGTCCACCAGATGAGTTTGGACCTAACAGGAATTCGTCAGTTGTTTCAACTTAGATATGTGAAGATTGAAGCCAATATTCATGTGCAGATACAATTGCCTGCTCAAATTCAGGAGCTAAAACTTTTGGAATCCATTGATATAGAATGGGGATCAGTTTGCATTCCACCAGATATTGTTCATCTGCCTCACTTGATTCATCTTGTTATCCCAGAAGGAACAGGATTGCCTGATGGGATCGGAAACTTGAAATCTCTGATCACTCTGCGTTCTTTTGATCTGGGGGAGAACTCGTTACATAATATCAGAAGTATCAGAGAGCTGACTAATCTGAAAGATCTCAATCTCTGTTACTCTGGAAAAAATGTAGTATCTAATATGGAGACATGGATTGATGTTTTGCGTTCTTCCCTTGAAAAGCTTTCCAACCTCAAATATCTACATTTATATTGGCCTGGTACTTGTGAAAATGGCCTATGTTCTTTGAACCCTCCATCCCGCCATCTTCAGAGACTGGAGATGGCGTACTGGTGGTTTTCCAAAGTTCCTAAGTGGATTGGAGGGCTCCATGAGCTTCACGTCTTGAAACTTGCAGTGAAGGAGGTGTCAGATGATGATATCACTCTTCTTGCACAACTGCCTTCCCTGACAAACCTTGGATTGCGCATGCGAGGAGCACCTAAGCAGAAGATAATTATCTATAAGAAGGCATTCCCAGTTCTCAGATACTTCAAATTCTGGTGTAGCACACCCTGCCTGGTCTTTGAGGCCTCCGTGATGAGCGAAGAGCTGCGGAATTAG


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa].

MAYEIEDWIDEAMHHLTKDDSNSGFISKIIFRLNRMRTQNRMANQINEVKTRVVEMSHRHKRYKLDASISTSDYTAIDPRLCALYADAEALVGMDGPRDEITKWFMGADQQLMVVSVLGIGGLGKTALANEVYKKIGGQFDCHAFISISQKPDIMCPPQNNHASRVITTTRIEKVAMECCSYRCEFIYKMKPLNEHDSRRLFFNRIFGSENACPERFKGVSTGILQRCGGLPLAIVSVSSLLANPATSVDRQWEYVSNSLSDKFGIMPALDGMRNILHLSYKNLPYHLKTCFLYLGIYPEDYIIRKSDVVRQWITEGFVHKAQVQDAEDVAGSYFNELVNRSMILPTDIDYQNNVVSCKLHDMMLDLILYEAAEERFFTVTDNFSTLLGLHNSVHRLSLQYDNGNHDTAAATTSLTYLRSLAIFGNSKYMHMHHLSDFKFLRVLITVFSDAVHQMSLDLTGIRQLFQLRYVKIEANIHVQIQLPAQIQELKLLESIDIEWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIRSIRELTNLKDLNLCYSGKNVVSNMETWIDVLRSSLEKLSNLKYLHLYWPGTCENGLCSLNPPSRHLQRLEMAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGLRMRGAPKQKIIIYKKAFPVLRYFKFWCSTPCLVFEASVMSEELRN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-672 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAYEIEDWIDEAMHHLTKDDSNSGFISKIIFRLNRMRTQNRMANQINEVKTRVVEMSHRHKRYKLDASISTSDYTAIDPRLCALYADAEALVGMDGPRDEITKWFMGADQQLMVVSVLGIGGLGKTALANEVYKKIGGQFDCHAFISISQKPDIMCPPQNNHASRVITTTRIEKVAMECCSYRCEFIYKMKPLNEHDSRRLFFNRIFGSENACPERFKGVSTGILQRCGGLPLAIVSVSSLLANPATSVDRQWEYVSNSLSDKFGIMPALDGMRNILHLSYKNLPYHLKTCFLYLGIYPEDYIIRKSDVVRQWITEGFVHKAQVQDAEDVAGSYFNELVNRSMILPTDIDYQNNVVSCKLHDMMLDLILYEAAEERFFTVTDNFSTLLGLHNSVHRLSLQYDNGNHDTAAATTSLTYLRSLAIFGNSKYMHMHHLSDFKFLRVLITVFSDAVHQMSLDLTGIRQLFQLRYVKIEANIHVQIQLPAQIQELKLLESIDIEWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIRSIRELTNLKDLNLCYSGKNVVSNMETWIDVLRSSLEKLSNLKYLHLYWPGTCENGLCSLNPPSRHLQRLEMAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGLR

HMMPanther: PTHR23155:SF163
1-672 OS08G0107000 PROTEIN,OS08G0107000 PROTEIN

MAYEIEDWIDEAMHHLTKDDSNSGFISKIIFRLNRMRTQNRMANQINEVKTRVVEMSHRHKRYKLDASISTSDYTAIDPRLCALYADAEALVGMDGPRDEITKWFMGADQQLMVVSVLGIGGLGKTALANEVYKKIGGQFDCHAFISISQKPDIMCPPQNNHASRVITTTRIEKVAMECCSYRCEFIYKMKPLNEHDSRRLFFNRIFGSENACPERFKGVSTGILQRCGGLPLAIVSVSSLLANPATSVDRQWEYVSNSLSDKFGIMPALDGMRNILHLSYKNLPYHLKTCFLYLGIYPEDYIIRKSDVVRQWITEGFVHKAQVQDAEDVAGSYFNELVNRSMILPTDIDYQNNVVSCKLHDMMLDLILYEAAEERFFTVTDNFSTLLGLHNSVHRLSLQYDNGNHDTAAATTSLTYLRSLAIFGNSKYMHMHHLSDFKFLRVLITVFSDAVHQMSLDLTGIRQLFQLRYVKIEANIHVQIQLPAQIQELKLLESIDIEWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIRSIRELTNLKDLNLCYSGKNVVSNMETWIDVLRSSLEKLSNLKYLHLYWPGTCENGLCSLNPPSRHLQRLEMAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGLR

superfamily: SSF52540
74-260 P-loop containing nucleoside triphosphate hydrolases

YTAIDPRLCALYADAEALVGMDGPRDEITKWFMGADQQLMVVSVLGIGGLGKTALANEVYKKIGGQFDCHAFISISQKPDIMCPPQNNHASRVITTTRIEKVAMECCSYRCEFIYKMKPLNEHDSRRLFFNRIFGSENACPERFKGVSTGILQRCGGLPLAIVSVSSLLANPATSVDRQWEYVSNSL

HMMPfam: PF00931
IPR002182
99-151 NB-ARC,NBS
NB-ARC

DEITKWFMGADQQLMVVSVLGIGGLGKTALANEVYKKIGGQFDCHAFISISQK

HMMPfam: PF00931
IPR002182
155-322 NB-ARC,NBS
NB-ARC

MCPPQNNHASRVITTTRIEKVAMECCSYRCEFIYKMKPLNEHDSRRLFFNRIFGSENACPERFKGVSTGILQRCGGLPLAIVSVSSLLANPATSVDRQWEYVSNSLSDKFGIMPALDGMRNILHLSYKNLPYHLKTCFLYLGIYPEDYIIRKSDVVRQWITEGFVHKA

superfamily: SSF52047
379-698 RNI-like,LRR

TVTDNFSTLLGLHNSVHRLSLQYDNGNHDTAAATTSLTYLRSLAIFGNSKYMHMHHLSDFKFLRVLITVFSDAVHQMSLDLTGIRQLFQLRYVKIEANIHVQIQLPAQIQELKLLESIDIEWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIRSIRELTNLKDLNLCYSGKNVVSNMETWIDVLRSSLEKLSNLKYLHLYWPGTCENGLCSLNPPSRHLQRLEMAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGLRMRGAPKQKIIIYKKAFPVLRYFKFWC

Gene3D: G3DSA:3.80.10.10
457-671 no description

LDLTGIRQLFQLRYVKIEANIHVQIQLPAQIQELKLLESIDIEWGSVCIPPDIVHLPHLIHLVIPEGTGLPDGIGNLKSLITLRSFDLGENSLHNIRSIRELTNLKDLNLCYSGKNVVSNMETWIDVLRSSLEKLSNLKYLHLYWPGTCENGLCSLNPPSRHLQRLEMAYWWFSKVPKWIGGLHELHVLKLAVKEVSDDDITLLAQLPSLTNLGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox