PRGDB00047202 (CTV.4)

From PRG Wiki
Revision as of 14:39, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693211 (EU254172)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Microcitrus australasica

Comment?

Microcitrus australasica cultivar Australian finger lime NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTTCTCTCCTTACTTTATTTATAAACAATAACGAACTCTTACGGAGAATCAACACTGACTTCTTGCAGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTTCGGGGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCACACTTATACGTGAGATTCCTGAAGATTTAAAGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACGCATGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTCGAGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTGATTTGGAACATCTAGAGGTATTGAGGTTGACCTTGGGAAGTTCTCGTGCCCTCCAAAGTTTTTTGACCTCACATATGCTACAAAGTTGTACTCAAGCTTTGCTCCTCCAAGACTTCAAAGGTTCGACCTCGGTTGATGTTCCTGGCTTGGCAAATCTGAAGCAGCTAAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAGCGTTATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTAAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAATCATAAGTGTGGGAGAATTTGCTGGAAATCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Microcitrus australasica].

VPTCPSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLEHLEVLRLTLGSSRALQSFLTSHMLQSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEIISVGEFAGNP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
4-263 PTHR23155:SF108,SUBFAMILY NOT NAMED

CPSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLEHLEVLRLTLGSSRALQSFLTSHMLQSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEIIS

superfamily: SSF52058
4-262 SSF52058,LRR

CPSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLEHLEVLRLTLGSSRALQSFLTSHMLQSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEII

Gene3D: G3DSA:3.80.10.10
4-112 G3DSA:3.80.10.10

CPSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGT

HMMPanther: PTHR23155
4-263 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLKALVNLKCLNLENACFLFKIPLQLISNFSRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLDLEHLEVLRLTLGSSRALQSFLTSHMLQSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEIIS

HMMPfam: PF13855
5-64 LRR_8,Leucine rich repeat

PSLLTLFINNNELLRRINTDFLQSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTT

Gene3D: G3DSA:3.80.10.10
159-252 G3DSA:3.80.10.10

FLTSHMLQSCTQALLLQDFKGSTSVDVPGLANLKQLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox