PRGDB00047216 (CTV.4)

From PRG Wiki
Revision as of 14:40, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
CTV.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 160693183 (EU254158)
Gene Class Unknown
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR
Gene Species Citrus aurantium

Comment?

Citrus aurantium cultivar Bouquet de fleurs sour orange NBS-LRR type disease resistance protein (CTV.4) gene, partial cds.

DNA Sequence

GGTTCCTACATGCCCTCATCTCCTTACTTTATTTCTTAACAATAACGAACTCTTACTGAGAATCAACACTGACTTCTTGCCGTCTATGCCTAGTCTCAAAGTTTTAAACCTCTCACGTTACATGGGATTATTGGAATTACCTTCGGGGATTTCAAAGTTGGTTTCACTTGAACACCTTGATCTTTCCACCACACTTATACGTGAGATTCCTGAAGATTTAACGGCGTTGGTAAATCTTAAATGTTTGAATTTGGAAAACGCAGGTTTTTTATTTAAAATTCCTCTGCAACTAATATCTAATTTTTTGAGGTTACATGTGCTGAGAATGTTCGGTACTGGTTATTTTTCCTGCGGCCTTTATCCAGAAGACAGCGTTTTATTTGGTGGGGGAGAACTCTTAGTAAAGGAGTTGCTTCATTTGAAACATCTAGAGGTATTGAGCTTGACCTTCGGAAGTTCTCATGCCCTCCAAAGTTTTTTGAACTCACATAAGTTACGAAGTTGTACTCAAGCTATGCTCCTCCAAGACTTCGAAGGTTCGACTTCGGTTGATGTTTCAGGCTTGGCAGATCTGAAGCGGCTCAAAAGATTACGGATTTCAGACTGTTATGAATTGGTAGAATTGAAGATTGATTATGCAGGGGAAGTACAACGTTATGGTTTCCACAGCCTTCAGAGTTTTGAAGTAAACTTTTGCTCTAAATTGAAGGACTTGACACTCCTTGTTTTGATTCCAAACCTCAAGTCCATTGCAGTAACAGATTGCGAGGCTATGGAAGAAANCANAANNGTGGGAGAANTTGCTNGNAANCCAAA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Citrus aurantium].

VPTCPHLLTLFLNNNELLLRINTDFLPSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLTALVNLKCLNLENAGFLFKIPLQLISNFLRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLHLKHLEVLSLTFGSSHALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEXXXVGEXAXXP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
4-260 PTHR23155:SF108,SUBFAMILY NOT NAMED

CPHLLTLFLNNNELLLRINTDFLPSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLTALVNLKCLNLENAGFLFKIPLQLISNFLRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLHLKHLEVLSLTFGSSHALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEE

HMMPanther: PTHR23155
4-260 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CPHLLTLFLNNNELLLRINTDFLPSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLTALVNLKCLNLENAGFLFKIPLQLISNFLRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLHLKHLEVLSLTFGSSHALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEE

superfamily: SSF52058
4-261 SSF52058,LRR

CPHLLTLFLNNNELLLRINTDFLPSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLTALVNLKCLNLENAGFLFKIPLQLISNFLRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLHLKHLEVLSLTFGSSHALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVSGLADLKRLKRLRISDCYELVELKIDYAGEVQRYGFHSLQSFEVNFCSKLKDLTLLVLIPNLKSIAVTDCEAMEEX

Gene3D: G3DSA:3.80.10.10
4-209 G3DSA:3.80.10.10

CPHLLTLFLNNNELLLRINTDFLPSMPSLKVLNLSRYMGLLELPSGISKLVSLEHLDLSTTLIREIPEDLTALVNLKCLNLENAGFLFKIPLQLISNFLRLHVLRMFGTGYFSCGLYPEDSVLFGGGELLVKELLHLKHLEVLSLTFGSSHALQSFLNSHKLRSCTQAMLLQDFEGSTSVDVSGLADLKRLKRLRISDCYELVELK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox