PRGDB00047455 (OSJNBa0083K01.34)

From PRG Wiki
Revision as of 14:32, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
OSJNBa0083K01.34
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 41237094 (AC147962)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 3 BAC OSJNBa0083K01 genomic sequence, complete sequence.

DNA Sequence

CAGCAACCAGAATTTGATAATGCAAGTTATGATCAAGAGGCTCTTGGTGCACTGAGCGACAATAGTGAGGATGATGTTGAAGTTTTCAATGAAGATGAAGATGACGATTTCTATGATGAAATGCTAGAAGTTGGGCAGTCAAGCGGGACAGCAATTAATGACGATGATGGAAGTAACGATGCTGTTTGAGAATGGATTGAGTGGCAACAGTCTCTAATAGACAAGGAAGATAAGCCAACCTGATTAATAAAGAGCATGTGCAAACTCTAAGATTAGATTGGTCTGATGGATTCTACTCTAGTGAATGTGATCATAATTCTAGTCATATAGATGTAAAAGCAACACCAGAATTAGCAGAGGAGGTATTTGAGAGCTTAAAGCCAACTAGCAACTTGGAGGAGTTAGAGGTAGCTGACTATTTTGGGTACAAATACCCAAGTTGGTTTGGAGGTTCTGCCTATTCACAATTGGCCAAGATAACTTTATGGAAGCAAGGCTGCAAGTTCCTTCCAACACTTGGCCAGTTACCTCAGTTGCGTAAACTTGTAGTTATACGCATGGAGGAAGTAGAGAGAATCGGGCAGGAGTTTCATGGCGAGAATTCCACAAATCGATTCCCAGTATTGGAGGAATTGGAGTTTGAGAACATGCCGAAATGGGTGGAGTGGACTGGAGTTTTTGATGGTGACTTCCCTTCACTTCGTGAGCTGAAAATCAAGGACAGCGGTGAATTGAGAACCCTTCCACATCAATTATCATCCTCTTTGAAAAAATTGGTCATCAAGAAATGTGAAAAGCTGACAAGACTGCCAACTATTCCCAACCTAACAATCTTACTTTTGATGGGCAATCTTAGCGAAGAAATACACAATAGTCTGGATTTTCCAATGCTCCAAATATTAAAAGAACCTGAAACTGAACCGGAGGAAGTTTCAATTCCTGATGAATTGGCTGTTCGGGTAAGAAAAATCCTAGAAAGATTTAAGGAGATCACAAAGGCATGGGATGATCTCCGTCTAGATGATACAGATACAACAATGCAAGATGAGGAACATAGCATGCTCCCACTGCCTACTACCCCATATGTTGACGAGCCCACTATCTTTGGTAGAGATGAAGATAAGGAAAAGATAATCAAAATGCTGCTCTCTGTGGGTGGTGCCAATGAAGGAGATGTGTCAGTTCTTCCCATTATTGGAATGGGTGGAGTAGGAAAGACAGCACTTGTTCAACTAGTGTACAATGATCGAAGGATTCTGAACAGATTTGACTTGATGGGCTGGGTTCATGTCTCAGAGAATTTTGATCTCAAAAGCATAATGCGTAAAATTATCATGTCCTTCACGAAAAAACCATGTCAGATGACACAAATGGATCAGCTCCAGTATATGCTAATAGAACAAGTTGTTGGCAGAAAGTTCTTGCTGGTTCTTGATGATGTGTGGAATGAGAGGAAGGATATTTGGGATGCATTATTATCAGCCATGTCACCTGCACAATCAAGCATAATATTGGTAACTACCCGCAATACAAGTGTGTCAACAATAGTCCAGACAATGCACCCCTACAATGTGAGTTGCCTACCTTTTGAGGAATCCTGGCAACTATTCAAGCAGATGGCCTTTTTGCACCAAGATGAGAGTATGAAAACAGATTTTGAGGTTATTGGCAGAAAAATTGTTCAGAAATGTGCTGGCTTGCCTTTAGCAGTGAAGGCAATTGCCAGTGCACTTCGCTTTGAGGAAAATGAGGAGAAATGGAATGACATATTGGAGAGTGAACAATGGGAGTTACCAACAACAGAGGATACTGTGTTACCGGCGTTAAAATTAAGCTATGATCAAATGCCAATCCACTTAAAGCGGTGCTTTGTTTTCTTCGCATTATTCCCTAAGAGGCATGTTTTCTTGAAGGAAAATGTGGTATATCTGTGGATATCTTTGGGCTTCCTTAAACGGACCAGCCAGACAAACCTTGAGACTATTGCAAGGTGCCTTAATGACTTGATGCAGAGGACTATGGTTCAGAAAATACTATTTGATGGAGGACATGATTGCTTCACCATGCATGACCTTGTACATGATCTTGCCGCGTCCATCTCATATGAAGATATTTTGAGAATAGACACTCAACACATGAAGTCTATGAATGAAGCATCAGGAAGCCTTAGGTATTTATCTCTGGTTGTGAGTTCTTCAGACCATGCGAATTTGGATTTGCGTACATTACCAGTGTCAGGAGGTATCAGGATATTTCAAGTTGTAAATTCTATGGATGACAATAGAAGATATTTTTCATCCTTCTTCAAAAATAACAGAAGATGCTTCTCCAAGTTGTTCTCACATCACATTAACCTTACAATTGATAATGAGCTATGGAGCAGTTTTCGGCATTTGAGAACTTTAGACTTAAGCCGCAGCTCAATGACAGCATTGCCTGATTCAATTAGAGGACTGAAGTTGCTCAGGTATCTAAGTATTTTCCAAACAAGAATCTCCAAGCTCCCAGAATCAATTTGTGACCTCCTTAATTTGAAGATCTTAGATGCAAGAACAAACTTTCTTGAAGAGCTACCACAAGGCATTCAGAAGCTGGTCAAGCTCCAGCATCTCAATTTAGTCCTTTGGTCTCCCCTGTGCATGCCAAAAGGAATTGGAAATCTGACCAAACTACAAACCTTGACAAGGTATAGTGTTGGAAGTGGCAATTGGCACTGCAATATTGCTGAACTACATTACTTAGTGAATATCCATGATGGCGAGGATCCAGCGCACGCTTGCTACCACCGATGAGCACAGCATCAGAGATGCATCTGAGAGGCTTCACCTGAGGGAGCTTCAGCAGTTTGCCTACGATGCCCAAGATGCAATCGATCTGTACAAGTTTGAGCTTCTGCGGCGAAGGATGGATGATCCAAACAGTCATGGAGATGGCGGCAGTAGCCGTAAACGCAAGCACAAGGGGGACAAGAAG


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Oryza sativa (japonica cultivar-group)].

MARIQRTLATTDEHSIRDASERLHLRELQQFAYDAQDAIDLYKFELLRRRMDDPNSHGDGGSSRKRKHKGDKKEPETEPEEVSIPDELAVRVRKILERFKEITKAWDDLRLDDTDTTMQDEEHSMLPLPTTPYVDEPTIFGRDEDKEKIIKMLLSVGGANEGDVSVLPIIGMGGVGKTALVQLVYNDRRILNRFDLMGWVHVSENFDLKSIMRKIIMSFTKKPCQMTQMDQLQYMLIEQVVGRKFLLVLDDVWNERKDIWDALLSAMSPAQSSIILVTTRNTSVSTIVQTMHPYNVSCLPFEESWQLFKQMAFLHQDESMKTDFEVIGRKIVQKCAGLPLAVKAIASALRFEENEEKWNDILESEQWELPTTEDTVLPALKLSYDQMPIHLKRCFVFFALFPKRHVFLKENVVYLWISLGFLKRTSQTNLETIARCLNDLMQRTMVQKILFDGGHDCFTMHDLVHDLAASISYEDILRIDTQHMKSMNEASGSLRYLSLVVSSSDHANLDLRTLPVSGGIRIFQVVNSMDDNRRYFSSFFKNNRRCFSKLFSHHINLTIDNELWSSFRHLRTLDLSRSSMTALPDSIRGLKLLRYLSIFQTRISKLPESICDLLNLKILDARTNFLEELPQGIQKLVKLQHLNLVLWSPLCMPKGIGNLTKLQTLTRYSVGSGNWHCNIAELHYLVNIHANLINKEHVQTLRLDWSDGFYSSECDHNSSHIDVKATPELAEEVFESLKPTSNLEELEVADYFGYKYPSWFGGSAYSQLAKITLWKQGCKFLPTLGQLPQLRKLVVIRMEEVERIGQEFHGENSTNRFPVLEELEFENMPKWVEWTGVFDGDFPSLRELKIKDSGELRTLPHQLSSSLKKLVIKKCEKLTRLPTIPNLTILLLMGNLSEEIHNSLDFPMLQILKEWIEWQQSLIDKEDKQQPEFDNASYDQEALGALSDNSEDDVEVFNEDEDDDFYDEMLEVGQSSGTAINDDDGSNDAV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
25-895 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRELQQFAYDAQDAIDLYKFELLRRRMDDPNSHGDGGSSRKRKHKGDKKEPETEPEEVSIPDELAVRVRKILERFKEITKAWDDLRLDDTDTTMQDEEHSMLPLPTTPYVDEPTIFGRDEDKEKIIKMLLSVGGANEGDVSVLPIIGMGGVGKTALVQLVYNDRRILNRFDLMGWVHVSENFDLKSIMRKIIMSFTKKPCQMTQMDQLQYMLIEQVVGRKFLLVLDDVWNERKDIWDALLSAMSPAQSSIILVTTRNTSVSTIVQTMHPYNVSCLPFEESWQLFKQMAFLHQDESMKTDFEVIGRKIVQKCAGLPLAVKAIASALRFEENEEKWNDILESEQWELPTTEDTVLPALKLSYDQMPIHLKRCFVFFALFPKRHVFLKENVVYLWISLGFLKRTSQTNLETIARCLNDLMQRTMVQKILFDGGHDCFTMHDLVHDLAASISYEDILRIDTQHMKSMNEASGSLRYLSLVVSSSDHANLDLRTLPVSGGIRIFQVVNSMDDNRRYFSSFFKNNRRCFSKLFSHHINLTIDNELWSSFRHLRTLDLSRSSMTALPDSIRGLKLLRYLSIFQTRISKLPESICDLLNLKILDARTNFLEELPQGIQKLVKLQHLNLVLWSPLCMPKGIGNLTKLQTLTRYSVGSGNWHCNIAELHYLVNIHANLINKEHVQTLRLDWSDGFYSSECDHNSSHIDVKATPELAEEVFESLKPTSNLEELEVADYFGYKYPSWFGGSAYSQLAKITLWKQGCKFLPTLGQLPQLRKLVVIRMEEVERIGQEFHGENSTNRFPVLEELEFENMPKWVEWTGVFDGDFPSLRELKIKDSGELRTLPHQLSSSLKKLVIKKCEKLTRLPTIPNLTILLLMGN

superfamily: SSF52540
122-371 SSF52540

EHSMLPLPTTPYVDEPTIFGRDEDKEKIIKMLLSVGGANEGDVSVLPIIGMGGVGKTALVQLVYNDRRILNRFDLMGWVHVSENFDLKSIMRKIIMSFTKKPCQMTQMDQLQYMLIEQVVGRKFLLVLDDVWNERKDIWDALLSAMSPAQSSIILVTTRNTSVSTIVQTMHPYNVSCLPFEESWQLFKQMAFLHQDESMKTDFEVIGRKIVQKCAGLPLAVKAIASALRFEENEEKWNDILESEQWELPT

Gene3D: G3DSA:3.40.50.300
130-280 G3DSA:3.40.50.300

TTPYVDEPTIFGRDEDKEKIIKMLLSVGGANEGDVSVLPIIGMGGVGKTALVQLVYNDRRILNRFDLMGWVHVSENFDLKSIMRKIIMSFTKKPCQMTQMDQLQYMLIEQVVGRKFLLVLDDVWNERKDIWDALLSAMSPAQSSIILVTTR

HMMPfam: PF00931
IPR002182
143-423 NB-ARC,NBS
NB-ARC

DEDKEKIIKMLLSVGGANEGDVSVLPIIGMGGVGKTALVQLVYNDRRILNRFDLMGWVHVSENFDLKSIMRKIIMSFTKKPCQMTQMDQLQYMLIEQVVGRKFLLVLDDVWNERKDIWDALLSAMSPAQSSIILVTTRNTSVSTIVQTMHPYNVSCLPFEESWQLFKQMAFLHQDESMKTDFEVIGRKIVQKCAGLPLAVKAIASALRFEENEEKWNDILESEQWELPTTEDTVLPALKLSYDQMPIHLKRCFVFFALFPKRHVFLKENVVYLWISLGFLK

FPrintScan: PR00364
IPR000767
166-181 DISEASERSIST
Disease resistance protein

VLPIIGMGGVGKTALV

FPrintScan: PR00364
IPR000767
239-253 DISEASERSIST
Disease resistance protein

QVVGRKFLLVLDDVW

FPrintScan: PR00364
IPR000767
335-349 DISEASERSIST
Disease resistance protein

CAGLPLAVKAIASAL

superfamily: SSF52058
459-912 SSF52058,LRR

TMHDLVHDLAASISYEDILRIDTQHMKSMNEASGSLRYLSLVVSSSDHANLDLRTLPVSGGIRIFQVVNSMDDNRRYFSSFFKNNRRCFSKLFSHHINLTIDNELWSSFRHLRTLDLSRSSMTALPDSIRGLKLLRYLSIFQTRISKLPESICDLLNLKILDARTNFLEELPQGIQKLVKLQHLNLVLWSPLCMPKGIGNLTKLQTLTRYSVGSGNWHCNIAELHYLVNIHANLINKEHVQTLRLDWSDGFYSSECDHNSSHIDVKATPELAEEVFESLKPTSNLEELEVADYFGYKYPSWFGGSAYSQLAKITLWKQGCKFLPTLGQLPQLRKLVVIRMEEVERIGQEFHGENSTNRFPVLEELEFENMPKWVEWTGVFDGDFPSLRELKIKDSGELRTLPHQLSSSLKKLVIKKCEKLTRLPTIPNLTILLLMGNLSEEIHNSLDFPMLQIL

Gene3D: G3DSA:3.80.10.10
562-683 G3DSA:3.80.10.10

ELWSSFRHLRTLDLSRSSMTALPDSIRGLKLLRYLSIFQTRISKLPESICDLLNLKILDARTNFLEELPQGIQKLVKLQHLNLVLWSPLCMPKGIGNLTKLQTLTRYSVGSGNWHCNIAELH

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

SSFRHLRTLDLSRSSMT

Gene3D: G3DSA:3.80.10.10
734-849 G3DSA:3.80.10.10

FESLKPTSNLEELEVADYFGYKYPSWFGGSAYSQLAKITLWKQGCKFLPTLGQLPQLRKLVVIRMEEVERIGQEFHGENSTNRFPVLEELEFENMPKWVEWTGVFDGDFPSLRELK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox