PRGDB00047530 (T6K12.30)

From PRG Wiki
Revision as of 14:31, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
T6K12.30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408745 (AC016829)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC T6K12 genomic sequence, complete sequence.

DNA Sequence

ATGGATTCTTCTTTTTTACTCGAAACTGTTGCTGCTGCAACAGGCTTCTTCACACTTTTGGGTACAATACTTTTTATGGTTTACAGAAAATTCAAAGACCATCGAGAAAACAAAGAAAATGATTCTTCTTCTTCAACACAACCGTCTCCTTCACCACCTCTGTCGTCTTTATCTCTCACGCGAAAATACGATGTCTTTCCAAGCTTCCGCGGGGAAGATGTCCGCAAAGACTTCCTCAGTCACATTCAGAAGGAGTTTCAAAGACAAGGAATCACACCATTTGTTGATAACAATATCAAGAGAGGAGAATCTATCGGTCCAGAACTCATTCGGGCGATTAGAGGGTCCAAGATCGCAATCATCTTGCTCTCCAAGAACTACGCTTCTTCAAGCTGGTGCTTAGACGAATTGGTGGAGATCATAAAGTGCAAGGAAGAAATGGGTCAAACAGTGATAGTCATTTTCTACAAAGTGGATCCATCTCTTGTAAAGAAGCTGACCGGTGATTTCGGGAAGGTATTCAGAAACACTTGTAAGGGTAAAGAAAGAGAAAACATTGAAAGATGGAGAGAAGCTTTCAAAAAAGTAGCAACAATAGCTGGTTACGATTCAAGAAAATGGGATAACGAATCGGGCATGATCGAAAAAATAGTCAGTGATATTTCGGAAATGCTGAATCATTCGACGCCGTCACGTGATTTTGACGATTTGATTGGGATGGGAGATCACATGGAAAAGATGAAACCATTGTTAGACATAGACTCAGATGAAATGAAGACGATAGGAATATGGGGTCCTCCTGGGGTTGGCAAAACCACCATTGCTAGATCTTTATATAATCAACACTCGGACAAATTTCAACTGAGTGTCTTTATGGAGAGTATCAAAACCGCGTACACAATACCAGCGTGTTCCGATGACTACTATGAAAAGTTGCAACTACAACAACGGTTTCTGTCTCAAATAACCAACCAGGAAAATGTCCAGATCCCACATTTAGGAGTTGCACAAGAAAGGTTGAACGACAAGAAAGTTCTTGTTGTTATTGATGATGTGAATCAGTCAGTACAAGTAGATGCCTTGGCGAAAGAAAATGATTGGCTAGGTCCTGGGAGTCGGATTATCATCACAACCCAAGACCGAGGAATTTTGAGGGCGCATGGGATCGAACATATTTACGAGGTGGATTATCCCAACTATGAAGAGGCCCTTCAAATCTTTTGCATGCATGCTTTTGGTCAAAAGTCCCCATATGATGGTTTTGAGGAGCTTGCTCAACAAGTTACAACACTTTCGGGTAGACTTCCTTTGGGACTTAAGGTTATGGGATCCTATTTCCGGGGAATGACCAAGCAGGAGTGGACAATGGCACTACCAAGGGTAAGGACTCACCTTGACGGAAAAATTGAGAGCATTCTAAAACTCAGTTACGATGCCTTATGTGATGTAGATAAAAGTTTGTTCCTTCATCTAGCTTGCTCTTTCCACAATGATGATACCGAGTTAGTAGAACAGCAGCTTGGAAAGAAGTTCTCGGATTTGAGGCAAGGGCTTCACGTCTTAGCTGAGAAATCGCTTATACATATGGATTTAAGACTGATACGTATGCATGTTCTGCTGGCACAACTTGGTAGAGAAATTGTTCGTAAACAATCCATTCATGAGCCTGGACAACGTCAATTTTTGGTTGATGCAACAGATATTCGTGAAGTACTCACTGATGATACAGGCAGTAGAAGTGTAATAGGCATAGATTTCGACTTCAATACGATGGAGAAAGAATTAGATATAAGTGAGAAAGCCTTCCGAGGAATGTCTAATCTTCAGTTCATAAGAATTTATGGTGACCTTTTTAGCCGTCACGGAGTATACTATTTTGGCGGTCGCGGTCACCGCGTGTCTCTGGATTATGATAGTAAATTGCACTTCCCGCGAGGTCTGGACTATTTACCTGGAAAACTTAGGTTATTACATTGGCAACAATTTCCGATGACAAGTTTGCCCTCTGAGTTTCATGCGGAGTTCCTTGTTAAACTATGCATGCCCTACAGCAAGCTTGAGAAGTTGTGGGAAGGAATTCAACCGCTTAGAAATCTCGAGTGGCTGGATTTGACTTGTTCCAGAAATCTGAAGGAGCTTCCTGATCTTTCAACAGCCACTAATCTCCAAAGACTGTCCATTGAGCGTTGCTCAAGTTTGGTGAAGCTCCCTTCCTCTATTGGGGAAGCCACTAATCTCAAGAAAATAAACTTGAGAGAGTGCTTATCTCTGGTGGAATTACCCTCCTCATTTGGGAATCTTACTAATCTCCAAGAATTGGATCTTAGAGAATGCTCAAGTCTAGTGGAGCTCCCAACCTCGTTTGGGAATCTTGCTAATGTTGAAAGCCTGGAATTTTATGAATGCTCAAGTTTGGTGAAGCTCCCATCAACTTTTGGGAATCTTACTAATCTCAGAGTGTTGGGTCTTAGAGAATGCTCAAGTATGGTGGAGCTCCCATCCTCGTTTGGGAATCTTACTAATCTCCAAGTATTGAATCTTAGAAAATGCTCAACTCTGGTGGAACTCCCCTCCTCATTTGTGAATCTTACTAATCTCGAAAATTTGGATCTTAGAGATTGCTCAAGTCTACTCCCCTCCTCGTTTGGGAATGTCACTTATCTCAAGAGATTGAAGTTTTATAAATGCTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDSSFLLETVAAATGFFTLLGTILFMVYRKFKDHRENKENDSSSSTQPSPSPPLSSLSLTRKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
61-198 G3DSA:3.40.50.10140

RKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVAT

ProfileScan: PS50104
IPR000157
61-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATI

HMMSmart: SM00255
IPR000157
62-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATI

HMMPfam: PF01582
IPR000157
65-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAF

HMMPanther: PTHR23155
73-896 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

HMMPanther: PTHR23155:SF299
73-896 PTHR23155:SF299

DVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

superfamily: SSF52540
116-489 SSF52540

SKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFL

Gene3D: G3DSA:3.40.50.300
233-270 G3DSA:3.40.50.300

DFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVG

HMMPfam: PF00931
IPR002182
242-497 NB-ARC,NBS
NB-ARC

DHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHN

HMMSmart: SM00382
IPR003593
257-398 AAA,NBS
AAA+ ATPase domain

EMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYP

FPrintScan: PR00364
IPR000767
260-275 DISEASERSIST
Disease resistance protein

TIGIWGPPGVGKTTIA

Gene3D: G3DSA:3.40.50.300
271-436 G3DSA:3.40.50.300

KTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLP

FPrintScan: PR00364
IPR000767
339-353 DISEASERSIST
Disease resistance protein

RLNDKKVLVVIDDVN

FPrintScan: PR00364
IPR000767
432-446 DISEASERSIST
Disease resistance protein

SGRLPLGLKVMGSYF

superfamily: SSF46785
467-573 SSF46785

GKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLT

superfamily: SSF52058
627-896 SSF52058,LRR

GGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

Gene3D: G3DSA:3.80.10.10
651-896 G3DSA:3.80.10.10

PGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

HMMPfam: PF07725
IPR011713
675-694 LRR_3
Leucine-rich repeat 3

FLVKLCMPYSKLEKLWEGIQ

HMMPfam: PF00560
IPR001611
745-767 LRR_1
Leucine-rich repeat

NLKKINLRECLSLVELPSSFGNL

FPrintScan: PR00364
IPR000767
765-781 DISEASERSIST
Disease resistance protein

GNLTNLQELDLRECSSL

HMMPfam: PF00560
IPR001611
769-791 LRR_1
Leucine-rich repeat

NLQELDLRECSSLVELPTSFGNL

HMMPfam: PF13855
816-874 LRR_8,Leucine rich repeat

TNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox