PRGDB00047537 (F3N23.36)

From PRG Wiki
Revision as of 14:31, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
F3N23.36
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5487890 (AC008017)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome I BAC F3N23 genomic sequence, complete sequence.

DNA Sequence

ATGAACACGATCTTTAAAAAATTATCCTGTTTTAAGAAAAAGGTTAAATCTTTACGAATATTCGAATCCAGGTCACTCTCTTCTTCGTCTTCTTCCTCATTCACTCCTCAAAAGTTCGACGTTTTTCTAAGCTTCAGAGGCAAAGATACTCGCAAGAACTTCGTCAGTTTTCTCTACAAGGCGCTAGTATCAAAAGGGATTCGAACTTTCAAAGACGACGAGGAATTGGAGAGAGGCCGTCCGATTCCGCCGGAGCTTCGCCAAGCAATCAAAGGGTCGAGAATCGCCGTGGTCGTGGTCTCTGTAACTTACCCTGCCTCGTCCTGGTGTCTCGAAGAACTCAGGGAGATTCTGAAACTTGAGAAGCTGGGTTTGCTCACTGTAATACCCATTTTCTATGAGATTAATCCTTCAGACGTGAGGAGACAGAGCGGAGTAGTCTCAAAACAGTTCAAGAAGCATGAGAAGAGACAGAGCAGAGAAAGAGTCAAATCGTGGAGGGAAGCGTTGACCAAATTGGCTAGTCTCTCCGGCGAGTGTTCAAAGAATTGGGAAGATGACTCGAAGCTGGTCGATGGAATTACTGAGAAGATATCAACAAAGTTGTTCTCGGAAAAACCAAGGAATGATAATATCCTAATTGGTATCGACCAACACATGGGGGAATTGTATCCACTATTTAACCTGAATTCGAATGAAGATGTTCAAGTCATTGGGATTTGGGGAAGAGGAAGTAATGGTAGATCAGCACTAGCAAGCCACGTTTACCAAAACATCAAACATCACTTTGAAGCTCATTGTTTTCTCGAAGACGTGAGACGGATTTCGCTACATTTCCGTGACTCTCATTTACAAGATGAGCTTCTTTCAAATATGCAAGGAGAAGGTTTGACAACAAAGAACTGTCATAGGTGTCTTAAGACTATCAAAGCAAGGCTAAGGAACAAGAAGGTTCTTCTTGTGGCGAACGATGTAGACAAACTTGAACAATTTGATGCACTTGCTGAAGAATTTAGCTGGTTTGGTCCTGGAAGCAGAATCATCATAACCACACAAGATAGACAATTGCTTATTTCATCAGTAGTGAGGAGTGTCTACGAAGTTAAGCTCTTGAGATGTTACGCAGTTCGTGAGCTCTTTAGGTCAAATGCCTTCAAAGAAAGAGAAAGAGACGATCCTGTTGGGTTCGACCAGTCTACATATCGAGCCATGTATATATCAGAGGTCAACTTAGAGAAAGGATAA


Protein sequences

Name Description Sequence
Similar to part of disease resistance protein Similar to part of disease resistance protein [Arabidopsis thaliana].

MNTIFKKLSCFKKKVKSLRIFESRSLSSSSSSSFTPQKFDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASLSGECSKNWEDDSKLVDGITEKISTKLFSEKPRNDNILIGIDQHMGELYPLFNLNSNEDVQVIGIWGRGSNGRSALASHVYQNIKHHFEAHCFLEDVRRISLHFRDSHLQDELLSNMQGEGLTTKNCHRCLKTIKARLRNKKVLLVANDVDKLEQFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRSVYEVKLLRCYAVRELFRSNAFKERERDDPVGFDQSTYRAMYISEVNLEKG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
27-179 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSSFTPQKFDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASLSGE

Gene3D: G3DSA:3.40.50.10140
37-174 G3DSA:3.40.50.10140

QKFDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLA

ProfileScan: PS50104
IPR000157
37-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKFDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASL

HMMSmart: SM00255
IPR000157
38-176 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASL

HMMPfam: PF01582
IPR000157
41-171 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALT

HMMPanther: PTHR23155:SF344
50-368 PTHR23155:SF344

TRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASLSGECSKNWEDDSKLVDGITEKISTKLFSEKPRNDNILIGIDQHMGELYPLFNLNSNEDVQVIGIWGRGSNGRSALASHVYQNIKHHFEAHCFLEDVRRISLHFRDSHLQDELLSNMQGEGLTTKNCHRCLKTIKARLRNKKVLLVANDVDKLEQFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRSVYEV

HMMPanther: PTHR23155
50-368 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVVVVSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKKHEKRQSRERVKSWREALTKLASLSGECSKNWEDDSKLVDGITEKISTKLFSEKPRNDNILIGIDQHMGELYPLFNLNSNEDVQVIGIWGRGSNGRSALASHVYQNIKHHFEAHCFLEDVRRISLHFRDSHLQDELLSNMQGEGLTTKNCHRCLKTIKARLRNKKVLLVANDVDKLEQFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRSVYEV

superfamily: SSF52540
195-390 SSF52540

TEKISTKLFSEKPRNDNILIGIDQHMGELYPLFNLNSNEDVQVIGIWGRGSNGRSALASHVYQNIKHHFEAHCFLEDVRRISLHFRDSHLQDELLSNMQGEGLTTKNCHRCLKTIKARLRNKKVLLVANDVDKLEQFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRSVYEVKLLRCYAVRELFRSNAFKERER

HMMPfam: PF00931
IPR002182
230-390 NB-ARC,NBS
NB-ARC

NSNEDVQVIGIWGRGSNGRSALASHVYQNIKHHFEAHCFLEDVRRISLHFRDSHLQDELLSNMQGEGLTTKNCHRCLKTIKARLRNKKVLLVANDVDKLEQFDALAEEFSWFGPGSRIIITTQDRQLLISSVVRSVYEVKLLRCYAVRELFRSNAFKERER

FPrintScan: PR00364
IPR000767
237-252 DISEASERSIST
Disease resistance protein

VIGIWGRGSNGRSALA

FPrintScan: PR00364
IPR000767
312-326 DISEASERSIST
Disease resistance protein

RLRNKKVLLVANDVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox