PRGDB00047539 (At2g03270)

From PRG Wiki
Revision as of 14:31, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At2g03270
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20197736 (AC006284)
Gene Class T
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 2 clone T4M8 map CIC11A04, complete sequence.

DNA Sequence

ATGACATTCTTCTCTCCCACTCAGGTGTTTTTGAACTACAGGGGAGAACAACTGCGTCGCAGCTTCGTGAGCCACCTCATTGATGCCTTTGAAAGGAATGAGATCAACTTCTTCGTAGACAAATACGAACAGAGAGGCAAAGACCTCAAAAATCTCTTTCTTAGGATCCAAGAGTCGAAGATCGCGCTTGCCATCTTCTCAACCAGATACACGGAGTCAAGCTGGTGTATGGATGAGTTGGTGAAGATAAAGAAACTTGCTGATAAAAGAAAGCTCCATGTCATTCCAATTTTCTACAAGGTGAAGGTAGAAGACGTTCGAAAACAGACAGGTGAGTTTGGTGACAACTTCTGGACGCTGGCAAAGGTTTCAAGTGGTGATCAGATCAAGAAATGGAAAGAAGCCTTGGAATGTATCCCCAACAAGATGGGTTTGTCGTTGGGAGACAAGAGTGATGAAGCAGATTTCATCAAGGAAGTTGTTAAGGCGGTTCAGTGTGTTGTAGCAACGATTGGACTTGAGGAAGAAGAGAATCATTTTGGGAAAAAGAAGAGAAAGGATTGCAAATGTGAGCTTCCTGATTTGAAGAAAAGCAGAACCAAAAAGTTGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR class), putative disease resistance protein (TIR class), putative [Arabidopsis thaliana].

MTFFSPTQVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNKMGLSLGDKSDEADFIKEVVKAVQCVVATIGLEEEENHFGKKKRKDCKCELPDLKKSRTKKL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
5-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SPTQVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNK

HMMSmart: SM00255
IPR000157
6-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PTQVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNK

superfamily: SSF52200
IPR000157
8-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNKMGL

Gene3D: G3DSA:3.40.50.10140
8-140 G3DSA:3.40.50.10140

QVFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIP

HMMPfam: PF01582
IPR000157
9-137 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLNYRGEQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALE

HMMPanther: PTHR23155:SF48
16-185 PTHR23155:SF48,SUBFAMILY NOT NAMED

EQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNKMGLSLGDKSDEADFIKEVVKAVQCVVATIGLEEEENHFGKKKR

HMMPanther: PTHR23155
16-185 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EQLRRSFVSHLIDAFERNEINFFVDKYEQRGKDLKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIKKLADKRKLHVIPIFYKVKVEDVRKQTGEFGDNFWTLAKVSSGDQIKKWKEALECIPNKMGLSLGDKSDEADFIKEVVKAVQCVVATIGLEEEENHFGKKKR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox