PRGDB00047544 (nucleotide binding site leucine-rich repeat disease resistance protein)

From PRG Wiki
Revision as of 14:31, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
nucleotide binding site leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644894 (AJ581790)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Pyrus communis

Comment?

Pyrus communis partial gene for putative nucleotide binding site leucine-rich repeat disease resistance protein, clone RGA03.

DNA Sequence

CCTAGCTCAACTCCTTTACAATAATGACAGGGTGAAAGAGCATTTCGATGTTCGAGCTTGGGCGTGTGTCTCCGAAGACTTTGATGCTGTTAGGGTCACTAAAACCCTTGTTCAGTCAATTGCTTCAAAACCCTGTGATACGTCAGATATGAGCTTGCTTCAAGTTGCTCTTAAGGAACAACTAACGGGGAAAAGGTTTCTACTTGTGTTGGATGACCTTTGGAATGACGATTATAATGATTGGAGTGTTCTACAAGCTCCTTTCACTTATGGGGCGAGGGGAAGTAAGGTCATTGTGACAACAAGGAACGAAAGTGTTGCATCCATCGTGCACACTGTTCCTATTCACTCTTTAAAACAATTGTCGCATGATGATTGTTGGTTGTTACTTGCAAAACATGCGTTTAGAAATGAAAACGCAAGTGCACATCCAGACTTGGAAGAAATTGGTAAAAAAATTGCACGTAAGTGCAATGGTCTGCCTTTAGCTTTCAAAGTA


Protein sequences

Name Description Sequence
nucleotide binding site leucine-rich repeat disease resistance protein nucleotide binding site leucine-rich repeat disease resistance protein [Pyrus communis].

LAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKHAFRNENASAHPDLEEIGKKIARKCNGLPLAFKV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
1-98 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVI

superfamily: SSF52540
1-166 SSF52540

LAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKHAFRNENASAHPDLEEIGKKIARKCNGLPLAFKV

HMMPanther: PTHR23155
1-98 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVI

HMMPfam: PF00931
IPR002182
1-166 NB-ARC,NBS
NB-ARC

LAQLLYNNDRVKEHFDVRAWACVSEDFDAVRVTKTLVQSIASKPCDTSDMSLLQVALKEQLTGKRFLLVLDDLWNDDYNDWSVLQAPFTYGARGSKVIVTTRNESVASIVHTVPIHSLKQLSHDDCWLLLAKHAFRNENASAHPDLEEIGKKIARKCNGLPLAFKV

FPrintScan: PR00364
IPR000767
60-74 DISEASERSIST
Disease resistance protein

QLTGKRFLLVLDDLW

FPrintScan: PR00364
IPR000767
157-166 DISEASERSIST
Disease resistance protein

CNGLPLAFKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox