PRGDB00047579 (pCol1)

From PRG Wiki
Revision as of 14:29, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
pCol1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3176752 (U97222)
Gene Class NL
Domain Type NBS, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (pCol1) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAAACAACGCTTCTTACGCAAATCAACAAGAGGTTTTCTGAAACAGATGGTGGATTTGATATTGTGATGTGGGTTGTTGTGTCTAAAACCTCAGAGATCTATAGGATACAAGAAGACATTGCAAAAAGACTAGGTCTTACGGGCGAGGAGTGGGACAAAAAAAACGAAAACAAGAGAGCCGTTGACATACACAATGTCCTTAGGAGACATAAATTTGTGTTATTGTTGGATGGTATATGCGAGAAAGTGAACTTAGAATTGGTTGGAGTACCGTATCCAAGTAGAGAAAATGGAAGCATAGTAGCATTTACCACCCGTTCTCGAGATGTTTGTGGGCGTATGGGAGTCGATGACCCGATGCAAGTTAGTTGTTTGGAACCTGAAGATGCTTGGGATTTGTTTCAAAACAAAGTAGGAGAAAACACTTTGAAAAGCCATCCGGATATTCCTGAACTTGCAAAACAAGTCGCTGAAAAATGTCGTGGTCTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

GGVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGICEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF119
1-105 RFL1 (RPS5-LIKE 1); ATP BINDING / PROTEIN BINDING,RFL1 (RPS5-LIKE 1)

GGVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGICEKVNLELVGVPYPSRENGSIV

superfamily: SSF52540
1-171 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGICEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLAL

HMMPanther: PTHR23155
1-105 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGICEKVNLELVGVPYPSRENGSIV

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGICEKVNLELVGVPYPSRENGSIVAFTTRSRDVCGRMGVDDPMQVSCLEPEDAWDLFQNKVGENTLKSHPDIPELAKQVAEKCRGLPLAL

Gene3D: G3DSA:3.40.50.300
2-83 no description

GVGKTTLLTQINKRFSETDGGFDIVMWVVVSKTSEIYRIQEDIAKRLGLTGEEWDKKNENKRAVDIHNVLRRHKFVLLLDGI


List of References

E Speulman, D Bouchez, E B Holub, J L Beynon
Disease resistance gene homologs correlate with disease resistance loci of Arabidopsis thaliana.
Plant J.: 1998, 14(4);467-74
PubMed:9670562 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox