PRGDB00048020 (nbs)

From PRG Wiki
Revision as of 16:13, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084774 (AM931426)
Gene Class NL
Domain Type NBS, LRR
Gene Species Musa banksii

Comment?

Musa banksii partial nbs gene for truncated NBS-LRR disease resistance protein, clone N223_BK.

DNA Sequence

GGAATGGGTGGGGTCGGGAAAACTACTCTTGCTCAGCAAGCGTACAACCACGCGAGGGTGCAGGACTGTTTTCAGCTTAAGGTCTGGGTCTGTGTATCCGACAACTTCAACGTGGAGAGGCTTACCAAAGAGATCATAGAATCCTTAACCAGGAATACGTGTGATCTCAATAACTTTGATACACTTCAAGTGGTAGTTAAGGAGAAGTTGACCTCAAAAAGGTTCCTGCTTGTCCTCGACGATGTGTGGAGCGAGGACAGCCTGAAATGA


Protein sequences

Name Description Sequence
truncated NBS-LRR disease resistance protein truncated NBS-LRR disease resistance protein [Musa banksii].

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDVWSEDSLK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
1-86 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDVWSED

superfamily: SSF52540
1-84 SSF52540

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDVWS

Gene3D: G3DSA:3.40.50.300
1-82 G3DSA:3.40.50.300

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDV

HMMPanther: PTHR23155
1-86 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDVWSED

HMMPfam: PF00931
IPR002182
1-88 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQQAYNHARVQDCFQLKVWVCVSDNFNVERLTKEIIESLTRNTCDLNNFDTLQVVVKEKLTSKRFLLVLDDVWSEDSL


List of References

M Azhar, J S Heslop-Harrison
Genomes, diversity and resistance gene analogues in Musa species.
Cytogenet. Genome Res.: 2008, 121(1);59-66
PubMed:18544928 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox