PRGDB00048108 (nbs)

From PRG Wiki
Revision as of 16:15, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
nbs
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 166084596 (AM931335)
Gene Class NL
Domain Type NBS, LRR
Gene Species Musa AAB Group

Comment?

Musa AAB Group partial nbs gene for NBS-LRR disease resistance protein, cultivar Pisang Mutiara, clone N151_MT.

DNA Sequence

GGAATGGGGGGAGTTGGTAAAACGACACTGGCTCAGAAAATATTCAATGATCCAAAGACGCAAGATATATTTCAGGTTCGGGCATGGGTTTGTGTTACACAGAAATTTTCAGAGATTGAATTGCTGAAGCAGATCATACGGGAAACCAGAGTGAACTACAGAGAAGATATGACAAAAGCGGAACTGCAACCGATGCTTAGAGATGCTGTTCGGGGAAAGAGTTTGTTTCTCGTGTTAGATGATGTGTGGCAAGCAGATGTATGGGTTGATTTGCTAAGAAATCCCGTACTACAAAGTGGAGTGGCTAATGGAAGAATTTTGGTGACCACCAGAGATGAAAACATTGCTCGCCAGATGGGGTCAGCACGCATCCATCGGGTGAAACTATTGCCGGATGATTCAGGTTGGGAACTGTTGTGCAAGAAGGCATTTGTCAGTGGAGGGGAGGAAGATATGGAGAACTTGAAGGACGTGGGCTTCGACATAGTTTCCAGATGCAAAGGCCTTCCCTTCGCTGCAAAGACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Musa AAB Group].

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRILVTTRDENIARQMGSARIHRVKLLPDDSGWELLCKKAFVSGGEEDMENLKDVGFDIVSRCKGLPFAAKT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-107 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRIL

HMMPanther: PTHR23155:SF121
1-107 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRIL

superfamily: SSF52540
1-175 SSF52540

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRILVTTRDENIARQMGSARIHRVKLLPDDSGWELLCKKAFVSGGEEDMENLKDVGFDIVSRCKGLPFAAKT

HMMPfam: PF00931
IPR002182
1-174 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRILVTTRDENIARQMGSARIHRVKLLPDDSGWELLCKKAFVSGGEEDMENLKDVGFDIVSRCKGLPFAAK

Gene3D: G3DSA:3.40.50.300
1-119 G3DSA:3.40.50.300

GMGGVGKTTLAQKIFNDPKTQDIFQVRAWVCVTQKFSEIELLKQIIRETRVNYREDMTKAELQPMLRDAVRGKSLFLVLDDVWQADVWVDLLRNPVLQSGVANGRILVTTRDENIARQM


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox