PRGDB00048250 (OSJNBa0035I03.41)

From PRG Wiki
Revision as of 16:19, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
OSJNBa0035I03.41
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 11602826 (AP003019)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0035I03.

DNA Sequence

CTGTTTGCAATATGACAAGTCTTCGAGAATTGCATCTAAACGGAAATTTTTTCTTTGGGGTGCTCCCATCATGTATCAGAAATCTAACTTTTCTCAGAGTACTTGATCTGTCAAATAATCTCTTAACGGCAAGGTTCCCCACTATTTCGTTCGCAAACATGACGTTACTTGAGCAACTTTCCCTTTCCCATAACCAGCTTGAAGGTCTGCTACTCCTAAACTCTTTTTCAAATCATCTCCAACTGAAATACCTGAGACTATCAAGCAACAGTGCCAGCTTCCAAGTGCAAACTGAGAATCCAGAAGCAAATATATCTAGTCAGCTTCAGGTTCTTGAACTATCAAACTGCAACCTGAATGCCAATTCTGGTGTTGTACCAAGTTTCTTATCACACCAGCACGGATTATACCTAATTGATGTTTCGAACAATAATCTAAGTGGTCATTTCCCGACGTGGTTACTGGAGAATAATATATATCTATCATACTTGAGTGTGAAACATAACTCATTTGTTGGATCACTCATTCTTCCTTCCACAGTAAATCAGAACTTATCATGGTTAGATGCATCTTATAACAGGCTAAGCGGGGACCTTCCTGTGGACATCAACATCACATTCCCTAATTTGAGCTACCTAAACTTATCGAAGAATTTTTTTCAAGGCATATTTCCTTCAGCCGTTAGTCACTTGGAGAATCTTTCAACTTTAGATTTATCTTACAACAACATATCGGGTGAAATAACTGCTAGTTTTCCTACAACTATGTCGATGAATCATCTAGTGCTAAACGATAATAATATCTCAGGGGAGATTCCTACTAGCATTTGCACCAACGTGAATCTTGGTGTGGTTGATTTTAGCAATAACAAGTTGACTGGATCCATTCCAAATTGCATAGCTTCAAATCATCTATTTTTTATCCTCAATCTAAGAGGGAATCATTTAACTGGATCAATTCCAACAGGTCTATCCAGCCTTTTGAATCTTCAATTTCTTGATCTGTCCAAAAACCATCTGTCTGGCCCCTTGCCTTCTTTGCCCAATTTGACATATCTCCACTTAAGTGAGAATGAACTGAATGGAACATTTCCCCTTGTCTGGCCATTCGGTGCTAATTTGAAGACAATGGATCTGCGATATAACCAATTCAGTGGTGCAATCCCAAGATGTATAGATGAAACTTTTCCAGAGTTACGAATACTATTGCTTAAGGGAAACATGTTCGAAGGGATGGTTCCAAACCAAGTGTGTCTACTTACCTAGGATTAAGCAAAATGAAGCTGGATATTCTTGATCTAAGTTGGAATGGAATTTTCGGGAACATATCAAGAGGTTTTGAAGTATGGTCTAATTTACGCCAACTGGAAATCCTCGATCTATCTGAAAATGAGTTGAATGATAGTAGTATCATGCCCTTGGTTGGACTTGCATCTCTGCGTTCCCCATTCCTCGGTGGGAACGCCATAAAGAATGACTTTACTGTCCAAAATGAGGAACCCCTGCATTTGGTGTTGCTTGGTTCTGCTGACCTTGGTGGTCTGCGACAGTTGTTTGCACGAAGAGAGGAAACATCTTATGGACATTTGCGATGCGTTCCTTTGGCCGGCTGGCAATCCGCCTGACTGGAGTAGCAGAGATTGCTGCCGGTGGGAGAGGGTGACCTGCAGCTCCATCACAGGGCGTGTCACGGCCCTTGATCTTGATGCAGCTTATCCGTCGTGGTATGGCCTACTCAACTGCAGTATGTTCCTTCCATTCCGTGAGCTGCAGAATTTGTCCTTGGGAAATGCCGGCATCGCGGGATGCATGCCTGGTGCAG


Protein sequences

Name Description Sequence
putative disease resistance protein Cf-2.1 putative disease resistance protein Cf-2.1 [Oryza sativa Japonica Group].

MRNPCIWCCLVLLTLVVCDSCLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAYPSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFLGGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSASFQVQTENPEANISSQLQVLELSNCNLNANSGVVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGSLILPSTVNQNLSWLDASYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHLSGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPRCIDETFPELRILLLKGNMFEGMVPNQVCLLT


Domains

Domain Start-End Description Sequence

Seg: seg
5-22 seg

CIWCCLVLLTLVVCDSCL

HMMPanther: PTHR24420:SF473
6-575 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IWCCLVLLTLVVCDSCLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAYPSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFLGGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSASFQVQTENPEANISSQLQVLELSNCNLNANSGVVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGSLILPSTVNQNLSWLDASYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHLSGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPR

HMMPanther: PTHR24420
6-575 FAMILY NOT NAMED,FAMILY NOT NAMED

IWCCLVLLTLVVCDSCLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAYPSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFLGGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSASFQVQTENPEANISSQLQVLELSNCNLNANSGVVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGSLILPSTVNQNLSWLDASYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHLSGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPR

superfamily: SSF52058
19-278 L domain-like,LRR

DSCLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAYPSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFLGGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSAS

Gene3D: G3DSA:3.80.10.10
21-359 no description

CLHEERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCSSITGRVTALDLDAAYPSWYGLLNCSMFLPFRELQNLSLGNAGIAGCMPGAGFEVWSNLRQLEILDLSENELNDSSIMPLVGLASLRSPFLGGNAIKNDFTVQRLSKMKLDILDLSWNGIFGNISRAVCNMTSLRELHLNGNFFFGVLPSCIRNLTFLRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNSASFQVQTENPEANISSQLQVLELSNCNLNANSGVVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGS

HMMPfam: PF08263
IPR013210
24-60 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EERKHLMDICDAFLWPAGNPPDWSSRDCCRWERVTCS

HMMSmart: SM00369
IPR003591
118-143 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRQLEILDLSENELNDSSIMPLVGLA

ProfileScan: PS51450
IPR001611
120-143 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEILDLSENELNDSSIMPLVGLA

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLDILDLSWNGIFGNISRAVCNM

HMMSmart: SM00369
IPR003591
190-213 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTSLRELHLNGNFFFGVLPSCIRN

HMMSmart: SM00369
IPR003591
214-238 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLRVLDLSNNLLTARFPTISFAN

ProfileScan: PS51450
IPR001611
216-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLRVLDLSNNLLTARFPTISFAN

HMMPfam: PF13855
217-276 LRR_8,Leucine rich repeat

LRVLDLSNNLLTARFPTISFANMTLLEQLSLSHNQLEGLLLLNSFSNHLQLKYLRLSSNS

HMMSmart: SM00369
IPR003591
239-263 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTLLEQLSLSHNQLEGLLLLNSFSN

ProfileScan: PS51450
IPR001611
241-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEQLSLSHNQLEGLLLLNSFS

FPrintScan: PR00019
242-255 LEURICHRPT,Leucine-rich repeat signature

LEQLSLSHNQLEGL

HMMPfam: PF13504
293-305 LRR_7,Leucine rich repeat

QLQVLELSNCNLN

superfamily: SSF52047
310-595 RNI-like,LRR

VVPSFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYLSYLSVKHNSFVGSLILPSTVNQNLSWLDASYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHLSGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPRCIDETFPELRILLLKGNMFE

HMMPfam: PF13516
367-385 LRR_6,Leucine Rich repeat

NQNLSWLDASYNRLSGDLP

Gene3D: G3DSA:3.80.10.10
368-601 no description

QNLSWLDASYNRLSGDLPVDINITFPNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNISGEIPTSICTNVNLGVVDFSNNKLTGSIPNCIASNHLFFILNLRGNHLTGSIPTGLSSLLNLQFLDLSKNHLSGPLPSLPNLTYLHLSENELNGTFPLVWPFGANLKTMDLRYNQFSGAIPRCIDETFPELRILLLKGNMFEGMVPNQ

ProfileScan: PS51450
IPR001611
369-391 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSWLDASYNRLSGDLPVDINIT

HMMSmart: SM00369
IPR003591
392-415 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FPNLSYLNLSKNFFQGIFPSAVSH

HMMPfam: PF13855
393-453 LRR_8,Leucine rich repeat

PNLSYLNLSKNFFQGIFPSAVSHLENLSTLDLSYNNISGEITASFPTTMSMNHLVLNDNNI

ProfileScan: PS51450
IPR001611
394-415 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSYLNLSKNFFQGIFPSAVSH

HMMSmart: SM00369
IPR003591
416-444 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LENLSTLDLSYNNISGEITASFPTTMSMN

FPrintScan: PR00019
416-429 LEURICHRPT,Leucine-rich repeat signature

LENLSTLDLSYNNI

ProfileScan: PS51450
IPR001611
418-440 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSTLDLSYNNISGEITASFPTT

ProfileScan: PS51450
IPR001611
442-464 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SMNHLVLNDNNISGEIPTSICTN

ProfileScan: PS51450
IPR001611
466-488 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLGVVDFSNNKLTGSIPNCIASN

ProfileScan: PS51450
IPR001611
489-513 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLFFILNLRGNHLTGSIPTGLSSLL

HMMPfam: PF00560
IPR001611
493-512 LRR_1
Leucine-rich repeat

ILNLRGNHLTGSIPTGLSSL

Seg: seg
509-521 seg

LSSLLNLQFLDLS

HMMSmart: SM00369
IPR003591
512-539 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLQFLDLSKNHLSGPLPSLPNLTYLH

ProfileScan: PS51450
IPR001611
514-536 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFLDLSKNHLSGPLPSLPNLT

HMMPfam: PF00560
IPR001611
514-535 LRR_1
Leucine-rich repeat

NLQFLDLSKNHLSGPLPSLPNL

ProfileScan: PS51450
IPR001611
558-580 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKTMDLRYNQFSGAIPRCIDET






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox