PRGDB00048340 (F-box protein)

From PRG Wiki
Revision as of 16:21, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

ATGAAGACTGTCATTGCTCGTACATCATCAAAACTGGCAAGGACTCCGAGGATGAATGAAGAAATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAGTGAAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTCTAGGTAAGACGACTTTAGCCAACAGACTCTATTCTGACAGGTCAGTTGTCTCTCAATTTGATATTTGTGCACAATGCTGTGTGTCTCAAGTATATTCGTATAAGGACTTGTTATTGTCCTTGCTACGTGATGCTATTGGTGACGAATCTGGGAGCAGAGAACTGCCTGACAATGAATTAGCTGATATGCTTCGCAAAACTTTATTGCCCCGAAGGTACCTTATCCTTGTTGATGACGTGTGGGACAATAGTGCTTGGGATGATTTAAGAGGTTGTTTTCCAGATGTCAATAACAGAAGCAGAATCATTCTAACGACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCATAGTGATCCCCTTCATCTTCGTATGTTTTACGAAGATGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAACAAAGCTGCTCCCCTCTCCTAAAAGATGTTGGGCTAAGAATAGCAAAATTGTGTGGAAAACTCCCTCTTTCAATTGTTTTTGTGGCTGGTACTCTGTCTGAGATGGAAAAGGAAGTAGAATCATTTTTAGAGGATAGAGTGATTGACATTTCAAGGTTAATACGGTTATGGATATCAGAATCATTTATAAAAAGTAGTGAAGGCAGAAGCTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTCATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCGATTCAGATGGTATGGTCAAAGCATGTCGCCTTCATGATGTATTACTCGACTTCTGCAAGAAAAGAGCAGCTGAGGAGAATTTTCTACTATGTATAAAACGGGATCAGAGTACCAAAGCTGTTATTTCTCACAAGCAGCAAGCTCACTTAGCCTTCAGTAAAATGGATAATCTTGTAGAATGGAGTGCATCTTCCTCACTTGTTGGCTCTGTAATTTTTAAGAGTTATGACCCATACTTTGCCCGTTGTCCCTTATCCTCTCATGCTTTTGCACTTTCACACATTTTAATAAATTTCAAGTTTCTTAAAGTATTGGATTTGGAGCACCAGGTTGTTATTGATTTTAATCCCACTGAGCACTTTTACTTGAGGTATCTATCTGCACACATTGATCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAAGCGTACACCAGCTGGGAGACTTAACACGCTACTACTACCTAGTACAATTTGGGATATGGTTAAACTGAGACATCTGCATATTCCTAACTTTAGAGCAGAAAGTGAAGATGCATTACTTGAGAACTCAGCAAAACTTTATGATTTGGAAACCCTTTCCACTACATATTTCTCTAGTGTTGAGAAGGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGATATGTGAAGTCCAGTTCTTAGAATACCCCAATCAGTACCATGTGTTGAATTTTCCAGTAAGGCTTGAAATGCTAAAGCTTTATCGATTTAATAACTCTAAAGTCATCCCCTTTTACATCTCTGCACCAAACCTCAAATACCTGAAACTCTCTGGCTTTTACCTGGATTCTCATTACTTATCAGAAACTGCTGATCATCTCAAGCACCTTGAGGTACTCAAACTGTACCGCGTTGAATTTGGCGATCATGGGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAAATTATGTGTGCTTGATGAAATGGATTGTAGCTGATGATGCATTTCCTAACCTTGAACAATTGGTTTTGCGCGGATGTAAAGATCTTATGGAGATCCCTTTTTGTTTCATGGACATCCTTTCTCTGAAGTACATTGAGTTAGACAACTGCAACAAGTCTGTTGTCAAGTCAGCCAAGGATATAGAAGAAGCACAAGTCGAAGATAATCAAAATACTAATTTCAAGCTCGTCATCATCAAGAAAATGATATTGCAATTCGATATTTCTCATGACAAAGAGATAGATAATGCATTTAAAAGATTAGCCTCTCTTCCAGGAGTAGACTCAATTTCAATTGATATGATAGAAAAGAAACTTACTGTGGGTGGAGATATGAATGCTAATGAAGTTCGATTAGTTGTGGGGAAACTGATAGACAGTGGCATGCTGTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MKTVIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAFKRLASLPGVDSISIDMIEKKLTVGGDMNANEVRLVVGKLIDSGML

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
4-245 SSF52540

VIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVID

HMMPanther: PTHR23155
7-715 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAF

HMMPanther: PTHR23155:SF121
7-715 PTHR23155:SF121,SUBFAMILY NOT NAMED

RTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAF

Gene3D: G3DSA:3.40.50.300
24-161 G3DSA:3.40.50.300

GFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRH

HMMPfam: PF00931
IPR002182
26-237 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVES

FPrintScan: PR00364
IPR000767
45-60 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
120-134 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
214-228 DISEASERSIST
Disease resistance protein

CGKLPLSIVFVAGTL

superfamily: SSF52058
300-673 SSF52058,LRR

RLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVK

Gene3D: G3DSA:3.80.10.10
381-516 G3DSA:3.80.10.10

ALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKL

Gene3D: G3DSA:3.80.10.10
537-669 G3DSA:3.80.10.10

RLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNK

FPrintScan: PR00364
IPR000767
654-670 DISEASERSIST
Disease resistance protein

MDILSLKYIELDNCNKS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox