PRGDB00048633 (NBS-LRR disease resistance protein, putative)

From PRG Wiki
Revision as of 16:30, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
NBS-LRR disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108862058 (DP000011)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 12, complete sequence.

DNA Sequence

GCCTTCTCCATACCATTTAGCGAGCAGTACATAAACGAACACCTTCCAATTGAAGATTTGCTTGTGACTGTGGTCGGATCAACTGTTTCCTACCCGATGAGACTAATGAAATCGAAAGATAAGCAAGCAACCTTCACAACTGGATGGAATAAGTTGGTTGGAGACAAATTATTCGAGCTATGTGATGTTTGTGTCTTCATGTTCAGTGAGAACGATGCTGAGCTTACTCTTAGCCTTGAGCTCCTCAACAACTGTGAAGGATGAGGTAGCAGCAGCATGAGCGATGCCACCGCCGCAGAAGACGCCGAAGACTGCTCCGCCACATCACTAATGCCTGAGAGCAAGAAGGAAGAAGGGAAAGGAGAAATGGGAGGGGTAGTGAGGTCATTTTCTACTCAATTTGCTGAGTTTGAGATGGCAGGAGCAATCGTGAGTGCTTCAGTTGGGGTGCTGAATCCCCTTCTAACCAAGCTTTCCTCCTTGATCGAGGGAGAGTACAAGCTGCTCAAAAGTGTGAAGAAGGATATCATCTTTTTGAGGAATGAGCTCAGCAGCATCAGTGTCTTGCTTGAGCATCTATCGAACAAGGAGGACAAGCTTGATGGGCCGACCATGGAGTGGAGGAACAACATGCTCGAGCTAGCTTATGATATTGAGGATTGCATCGACCTCTTCATCCACAAGTTGAGTTGTGGCGATGCCAATGCCAACTTTGTTCGCAAGATAGGAAGCAAGATAAAGAAGCTATGGGGAAAACACCAGATCACAGAGTGTATCCAAGAACTGAAGAATCGGGTTATGGAGGAGGACCAACGTCGCAAGCGGTATCAGATCGATGATTTCATCTCCGAGCCAAGTATGGTGGAAATTGATCCCCGTCTGCTGGCATTGTATGAGGAGGTGGAGAGGCTCGTAGGGATTGATGGTCCAAGGGAGAAGATCGTTAAGTGGATCATGCACAAAGATTGGTCATCAGAACAACGCAAAGTGGTTTCGATTGTTGGTTGGGTG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein, putative NBS-LRR disease resistance protein, putative [Oryza sativa (japonica cultivar-group)].

MAGAIVSASVGVLNPLLTKLSSLIEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSNKEDKLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVKWIMHKDWSSEQRKVVSIVGWVGSSSMSDATAAEDAEDCSATSLMPESKKEEGKGEMGGVVRSFSTQFAEFEAFSIPFSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKDKQATFTTGWNKLVGDKLFELCDVCVFMFSENDAELTLSLELLNNCEG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-197 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVGVLNPLLTKLSSLIEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSNKEDKLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVKWIMHKDWSSEQRKVVSIVG

HMMPanther: PTHR23155:SF223
9-197 PTHR23155:SF223,OS12G0270300 PROTEIN

SVGVLNPLLTKLSSLIEGEYKLLKSVKKDIIFLRNELSSISVLLEHLSNKEDKLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITECIQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVKWIMHKDWSSEQRKVVSIVG

superfamily: SSF101936
IPR015300
240-334 Restrict_endonuc_II_EcoRII_N
DNA-binding pseudobarrel domain

SFSTQFAEFEAFSIPFSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKDKQATFTTGWNKLVGDKLFELCDVCVFMFSENDAELTLSLELLNNC

Gene3D: G3DSA:2.40.330.10
IPR015300
255-321 G3DSA:2.40.330.10
DNA-binding pseudobarrel domain

FSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKDKQATFTTGWNKLVGDKLFELCDVCVFMFSEND


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox