PRGDB00048643 (NBS-LRR type disease resistance protein, putative, expressed)

From PRG Wiki
Revision as of 16:30, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
NBS-LRR type disease resistance protein, putative, expressed
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108863896 (DP000010)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, LRR, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 11, complete sequence.

DNA Sequence

ATGTGGGTATGGGGTACCCATAATCTCCACAAGTTTGGCTCTGCAAATGATTTTGGCACAATGGTAGAGATTGATAAGGATGTTCGTCGTTTGTCATCTTACCGATGGAAAGACGGTACTGCACCCAGACTTAATCTTCCACGCCTTCGAACTCTAGTATCACTTGAAGCAATTTCATCTTCCCCAGACATGTTGTCCTCAATTTTGTATGGATCAAGCTATCTTACTGTTCTTGAGCTTCAAGATTCAGAAATCACTCAAGTGCCAGCAACTATAGGGAATTTATGTAACTTGCGTTATATTGGCTTGCGACGCACCAAGGTGAAATCACTCCCGGGCTCTGTTGAAAAGTTATCAAACCTCCAAACGCTAGACATCAGGCAAACGCATATAGAGAGTCTACCACAAGGAATCACTAAAATAAAAAAGCTAAGGCACTTGTTAGCTGATAGATATGCTGATGAAAAGCACTCAGAGTTCCGGTTTTTCATAGGAATGCAAGCACCTAAAGATATGTCCAACCTTAAAGAACTACAAACTCTTGAGACCATGGAAGCGAGCAAAGACTTGGCCAAGCAGCTGAAGGAACTAATACAACTACAAAGTGTGTGGATTGATGGCATAAGTTCTGTCGATTGTCAAAATATTTTTGATTCACTATCAAAGATGCCGCTTCTTTCTAGTTTGCTTCTTTCTGCAAGGGATCAGAATGAACGACTCTGCTTTGAGGCATTCAAGCCCATCTCCACTCAATTACACAGGTTAATTATCAGAGGGAAATGGGCCACTGGAACAATGGACTGCCCAATATTTCGTACCCATGGCACATGTGTCAAATATTTAGCTCTAAGTTGGTGTGATCTTGGGGATGATCCATTAAGGATGCTTGCATTATTGCACTTGCCAAATCTCACACATCTGAGACTGAGCAACATGCATAATGCAAAAAAGTTGGTTCTATATGCAGAAAACTTTTTCCGCCTGAAGTCCCTTGTTTTGAAGGACATGCCACATGTCAACCAGATAAATATTATAGGTGGCTCTCTGTCATGCATTGAAGCTTTGTACATCTTGGCACTGCCAAACCTGGACAAAGTCCCACTGGGCATTGAATCCATTCTCTCCCTGAAGAAACTATGGCTGCTGGGCTTGCACATGGACTTTAGGAAGCAATGGAACAATAGTGGAATGCACCAGAAGATGCAGCATATTCCAGAGTCTTTCATGTCCCTCAATGCCAGATCAGATGTACATCATCTACTTCTCTCTACAATGGGGATGAGCTCAGTCTCTCAGGAGGATTTGGGTCATCAAAAATGGACCATAACATGTAAACATGGTATACTGGAGGACAAGTTAGAGGCTCCACGTGCAACTCCAATGTATGCCGTGCCTTCCGAGTTCTCAAAAACTGTGGAGCCAACAGATCTAAAGCATGAGTTTCTAAAAGAAATTACAAACAATTTCTCCAAGGAACAAATACTTGGTCAAGGAGCATTTGGAACTGTTTACCGGACATGCTATCAATCCTCATGA


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein, putative, expressed NBS-LRR type disease resistance protein, putative, expressed [Oryza sativa (japonica cultivar-group)].

MWVWGTHNLHKFGSANDFGTMVEIDKDVRRLSSYRWKDGTAPRLNLPRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPESFMSLNARSDVHHLLLSTMGMSSVSQEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRTCYQSS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
42-175 G3DSA:3.80.10.10

PRLNLPRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNL

superfamily: SSF52047
46-387 SSF52047,LRR

LPRLRTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMD

HMMPanther: PTHR24420
50-505 PTHR24420,FAMILY NOT NAMED

RTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPESFMSLNARSDVHHLLLSTMGMSSVSQEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYR

HMMPanther: PTHR24420:SF757
50-505 PTHR24420:SF757

RTLVSLEAISSSPDMLSSILYGSSYLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHIESLPQGITKIKKLRHLLADRYADEKHSEFRFFIGMQAPKDMSNLKELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEALYILALPNLDKVPLGIESILSLKKLWLLGLHMDFRKQWNNSGMHQKMQHIPESFMSLNARSDVHHLLLSTMGMSSVSQEDLGHQKWTITCKHGILEDKLEAPRATPMYAVPSEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYR

HMMPfam: PF13855
74-131 LRR_8,Leucine rich repeat

YLTVLELQDSEITQVPATIGNLCNLRYIGLRRTKVKSLPGSVEKLSNLQTLDIRQTHI

Gene3D: G3DSA:3.80.10.10
176-355 G3DSA:3.80.10.10

KELQTLETMEASKDLAKQLKELIQLQSVWIDGISSVDCQNIFDSLSKMPLLSSLLLSARDQNERLCFEAFKPISTQLHRLIIRGKWATGTMDCPIFRTHGTCVKYLALSWCDLGDDPLRMLALLHLPNLTHLRLSNMHNAKKLVLYAENFFRLKSLVLKDMPHVNQINIIGGSLSCIEAL

Gene3D: G3DSA:3.30.200.20
466-509 G3DSA:3.30.200.20

SEFSKTVEPTDLKHEFLKEITNNFSKEQILGQGAFGTVYRTCYQ


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox