PRGDB00049060 (At5g43470/MWF20_19)

From PRG Wiki
Revision as of 16:42, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At5g43470/MWF20_19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26452734 (AK118862)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At5g43470 mRNA for putative disease resistance protein RPP8, complete cds, clone: RAFL21-19-F01.

DNA Sequence

ATGGCTGAAGCATTTGTGTCGTTTGGACTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGGGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGTTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAATTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGTGGAAAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAGAGGATCTCTGAAGTGATTGGGGAAATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAGAGCGATCTTGTCGGGGTGGAGCAGAGTGTTAAAGAATTGGTTGGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGACTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCCCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATATGCACTTCAGCGTAAACTCTTTCAATTGTTAGAGGCCGGTAGATATTTAGTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATGTAATAAAAGCAGTGTTTCCACGGAAAAGAGGTGAGCTCTTATGGTACATACATGAAGCACTTTTTCTTCTTAATTCATAA


Protein sequences

Name Description Sequence
putative disease resistance protein RPP8 putative disease resistance protein RPP8 [Arabidopsis thaliana].

MAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFLLNS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-305 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFL

HMMPanther: PTHR23155
2-305 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGELLWYIHEALFL

superfamily: SSF52540
148-292 SSF52540

RVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKR

HMMPfam: PF00931
IPR002182
169-292 NB-ARC,NBS
NB-ARC

EQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKR

Gene3D: G3DSA:3.40.50.300
170-278 G3DSA:3.40.50.300

QSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKK

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLEAGRYLVVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox