PRGDB00049061 (At5g46480/K11I1_7)

From PRG Wiki
Revision as of 16:42, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
At5g46480/K11I1_7
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26452407 (AK118695)
Gene Class T
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At5g46480 mRNA for putative disease resistance protein, complete cds, clone: RAFL19-96-D01.

DNA Sequence

ATGGATCTCCCGGTCATACCAATTTTCTACGGTTTGGATCCTTCTCATGTGAGGAAACAAACCGGAGAATTTGGAAAGAATTTTGAGAAGACTTGCAGAAACGAAACAGAGGCATGTGTATATCAGTGGGGAAGAGCTCTGTGCGATGTATCTAATTTCCTCGGATATCATTCTCCGAACTGGTACAATTCTTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDLPVIPIFYGLDPSHVRKQTGEFGKNFEKTCRNETEACVYQWGRALCDVSNFLGYHSPNWYNS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-56 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MDLPVIPIFYGLDPSHVRKQTGEFGKNFEKTCRNETEACVYQWGRALCDVSNFLGY

ProfileScan: PS50104
IPR000157
1-53 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MDLPVIPIFYGLDPSHVRKQTGEFGKNFEKTCRNETEACVYQWGRALCDVSNF

HMMPfam: PF01582
IPR000157
5-37 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VIPIFYGLDPSHVRKQTGEFGKNFEKTCRNETE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox