PRGDB00049220 (disease resistance protein RPP1-WsA)

From PRG Wiki
Revision as of 16:46, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein RPP1-WsA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3860162 (AF098962)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-WsA gene, complete cds.

DNA Sequence

ATGGATTCTTCTTTTTTCCTTGTCTTAGTCGCAGCTGCTACAGGCTTCTTCATGCTTTTTAGAAAATTCAGATTCCATCAAGATAACAAAGAAAGTAATTCTTCTTCTTTATCTCGTCCAACTGCTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCACGGAGCAGATGTCCGAAGAACCTTTCTTAGTCACATCCTCGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGGAAATATGCTTCTTCGTCATGGTGTCTTGATGAGTTGGCCGAGATCATGAAATGCAGGGAAGTGTTGGGTCAGATTGTCATGACCATTTTCTATGAAGTGGAGCCAACTGACATAAAGAAACAGACTGGTGAATTCGGAAAAGCCTTCACAAAAACATGTAGAGGTAAAACAAAAGAGCATATTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAAATGGAGCAATGAAGCGGAGATGATTGAAAAGATATCCACTGATGTTTCAAACATGTTGGATTTATCCATACCATCAAAAGATTTCGATGATTTTGTTGGGATGGCAGCTCATATGGAAAGGACGGAACAATTGTTACGCCTAGATTTGGATGAAGCAAGGATGATCGGGATTTGGGGACCGCCTGGGATCGGTAAGACAACTATCGCCAGATTTCTGTTTAATCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTCGTTCTTGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGATACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCAAGGAATTTTGAAGGCACATGGAATCAATCATGTTTACAAAGTGGAATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCGTACGAAGGTTTCTGTGACCTTGCTTGGGAGGTTAAGGCTTTAGCTGGTGAACTCCCTTTGGGATTGAAGGTTCTAGGCTCCGCTTTGCGGGGGATGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAGAACTAGCCTCGACGGAAAAATCGGGGGCATTATACAGTTCAGTTACGATGCCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGCCTTTTTAACAACGAATCAACAACCAAAGTGGAAGAGGTTCTTGCAAACAAGTTCTTGGATGTGGGGCAAGGTATTCACGTGTTAGCTCAAAAATCTCTCATATCCTTTGAGGGAGAAGAAATACAGATGCATACTCTGCTAGAACAGTTTGGAAGAGAAACTTCCCGTAAGCAATTCGTTCATCACCGCTATACGAAACATCAGCTTTTGGTGGGTGAAAGGGATATATGTGAAGTACTCAATGACGATACAATAGATAGTAGACGTTTTATAGGGATACATTTGGATTTATCTAAGAATGAGGAAGAATTGAATATAAGTGAGAAAGCACTTGAAAGAATCCATGATTTTCAATTCGTTAGAATCAATGATAAGAATCATGCTCTACATGAGAGACTACAAGATTTGATTTGTCATTCTCCAAAGATTAGATCACTGAAGTGGTATAGTTACCAGAATATATGTTTGCCTTCAACTTTTAATCCGGAGTTTCTCGTCGAACTAGATATGAGTTTCAGCAAGCTTCAGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTTATTCTAGTTATCTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAATCTTAGAAATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACCAGTCTCCAGATATTAGATCTCCAAGGTTGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGAATGCAACTAAACTTGAGATACTTTATCTTGATTATTGTCGGAGTCTTGAGAAGCTCCCACCATCTATCAATGCCAATAATCTCCAGAAATTGTCTCTAAGAAATTGTTCACGTATTGTGGAGCTCCCCGCTATCGAGAATGCGACTAATCTCTGGGAATTGAATCTGCTTAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCAGAAATCTATTTTTGAAGGAATTGAATATTAGCGGATGCTCAAGTCTCGTGAAACTCCCATCCTCTATTGGAGATATGACTAATCTCAAAGAGTTTGATCTATCTAACTGCTCAAATCTGGTGGAGCTTCCTTCCTCTATAGGAAACCTTCAAAACTTGTGCAAGTTAATTATGAGAGGATGCTCAAAGCTAGAGGCTCTTCCAATCAACATCAACTTGAAATCTCTCGATACACTTAATCTCACAGATTGCTCTCAGTTGAAAAGTTTTCCTGAGATCTCCACACACATTAAGTATCTCAGGCTCACAGGAACTGCAATAAAAGAAGTTCCCTTGTCGATCATGTCGTGGTCTCCTCTTGCTGAATTTCAGATTTCATATTTTGAAAGCCTCAAGGAATTCCCGCATGCTTTTGACATCATCACGGAGCTGCAGTTGAGCAAAGATATACAAGAAGTTACTCCATGGGTCAAGAGAATGTCTCGTTTACGTTATTTTAGACTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTCCAGATTCCCTTGCTTACTTATATGCAGATAATTGTAAGTCCCTCGAGAAACTAGATTGTTGCTTTAACAATCCATGGATTAGTCTCCATTTCCCCAAATGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCGACTTCTAGAATTGCGATGTTACCCGGTACACAAGTGCCTGCCTGCTTCAATCATCGAGCTACTTCTGGGGATTACTTGAAAATCAAGTTGAAGGAGTCGCCTCTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTATGGTTAATGAAGGAATTAGTTATGATAGGAAAATCAAGTTGAGCGTTGACATCAGGGATGAACAGAATGATCTCAAAGTTCAGTGTACACCAAGCGGCTGTTATATATATCCACTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACACTAGACAAGGAAAGCAATTGGAAGATAGGAGAATGCGGGATACTCCAAAGAGAAACGAGATCACTGCGCCGGAGCTCTTCGCCGGATCTCCCGTCGGAATCTTCTCGTGTTTCTAGCTACAACCACTGTTAG


Protein sequences

Name Description Sequence
disease resistance protein RPP1-WsA disease resistance protein RPP1-WsA [Arabidopsis thaliana].

MDSSFFLVLVAAATGFFMLFRKFRFHQDNKESNSSSLSRPTAATSVSRNWKHDVFPSFHGADVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWSNEAEMIEKISTDVSNMLDLSIPSKDFDDFVGMAAHMERTEQLLRLDLDEARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPYEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNNESTTKVEEVLANKFLDVGQGIHVLAQKSLISFEGEEIQMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLNDDTIDSRRFIGIHLDLSKNEEELNISEKALERIHDFQFVRINDKNHALHERLQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELNLRNCSSLVELPSSIEKLTSLQILDLQGCSSLVELPSFGNATKLEILYLDYCRSLEKLPPSINANNLQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELPLSIGTARNLFLKELNISGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHIKYLRLTGTAIKEVPLSIMSWSPLAEFQISYFESLKEFPHAFDIITELQLSKDIQEVTPWVKRMSRLRYFRLNNCNNLVSLPQLPDSLAYLYADNCKSLEKLDCCFNNPWISLHFPKCFKLNQEARDLIMHTSTSRIAMLPGTQVPACFNHRATSGDYLKIKLKESPLPTTLRFKACIMLVMVNEGISYDRKIKLSVDIRDEQNDLKVQCTPSGCYIYPLTEHIYTFELEVEEVTSTELVFEFTLDKESNWKIGECGILQRETRSLRRSSSPDLPSESSRVSSYNHC

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
48-186 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVA

ProfileScan: PS50104
IPR000157
50-188 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMSmart: SM00255
IPR000157
51-188 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMPfam: PF01582
IPR000157
54-183 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALE

HMMPanther: PTHR23155:SF296
62-1046 PTHR23155:SF296

DVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWSNEAEMIEKISTDVSNMLDLSIPSKDFDDFVGMAAHMERTEQLLRLDLDEARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPYEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNNESTTKVEEVLANKFLDVGQGIHVLAQKSLISFEGEEIQMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLNDDTIDSRRFIGIHLDLSKNEEELNISEKALERIHDFQFVRINDKNHALHERLQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELNLRNCSSLVELPSSIEKLTSLQILDLQGCSSLVELPSFGNATKLEILYLDYCRSLEKLPPSINANNLQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELPLSIGTARNLFLKELNISGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHIKYLRLTGTAIKEVPLSIMSWSPLAEFQISYFESLKEFPHAFDIITELQLSKDIQEVTPWVKRMSRLRYFRLNNCNNLVSLPQLPDSLAYLYADNCKSLEKLDCCFNNPWISLHFPKCFKLNQEARDLIMHTSTSRIAMLPGTQ

HMMPanther: PTHR23155
62-1046 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRRTFLSHILESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWSNEAEMIEKISTDVSNMLDLSIPSKDFDDFVGMAAHMERTEQLLRLDLDEARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPYEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNNESTTKVEEVLANKFLDVGQGIHVLAQKSLISFEGEEIQMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLNDDTIDSRRFIGIHLDLSKNEEELNISEKALERIHDFQFVRINDKNHALHERLQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELNLRNCSSLVELPSSIEKLTSLQILDLQGCSSLVELPSFGNATKLEILYLDYCRSLEKLPPSINANNLQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELPLSIGTARNLFLKELNISGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHIKYLRLTGTAIKEVPLSIMSWSPLAEFQISYFESLKEFPHAFDIITELQLSKDIQEVTPWVKRMSRLRYFRLNNCNNLVSLPQLPDSLAYLYADNCKSLEKLDCCFNNPWISLHFPKCFKLNQEARDLIMHTSTSRIAMLPGTQ

superfamily: SSF52540
105-477 SSF52540

SKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWSNEAEMIEKISTDVSNMLDLSIPSKDFDDFVGMAAHMERTEQLLRLDLDEARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPYEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
221-260 G3DSA:3.40.50.300

KDFDDFVGMAAHMERTEQLLRLDLDEARMIGIWGPPGIGK

HMMPfam: PF00931
IPR002182
233-490 NB-ARC,NBS
NB-ARC

MERTEQLLRLDLDEARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPYEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGGIIQFSYDALCDEDKYLFLYIACLFNNESTTK

HMMSmart: SM00382
IPR003593
246-384 AAA,NBS
AAA+ ATPase domain

EARMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKDTRWFGPGSRIIITTEDQGILKAHGINHVYKVE

FPrintScan: PR00364
IPR000767
249-264 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
261-331 G3DSA:3.40.50.300

TTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDK

FPrintScan: PR00364
IPR000767
327-341 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
420-434 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF52058
522-827 SSF52058,LRR

IQMHTLLEQFGRETSRKQFVHHRYTKHQLLVGERDICEVLNDDTIDSRRFIGIHLDLSKNEEELNISEKALERIHDFQFVRINDKNHALHERLQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELNLRNCSSLVELPSSIEKLTSLQILDLQGCSSLVELPSFGNATKLEILYLDYCRSLEKLPPSINANNLQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELPLSIGTARNLFLKELNISGCSSLVKLPS

Gene3D: G3DSA:3.80.10.10
576-800 G3DSA:3.80.10.10

LDLSKNEEELNISEKALERIHDFQFVRINDKNHALHERLQDLICHSPKIRSLKWYSYQNICLPSTFNPEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELNLRNCSSLVELPSSIEKLTSLQILDLQGCSSLVELPSFGNATKLEILYLDYCRSLEKLPPSINANNLQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELP

HMMPfam: PF07725
IPR011713
645-664 LRR_3
Leucine-rich repeat 3

FLVELDMSFSKLQKLWEGTK

HMMPfam: PF00560
IPR001611
691-713 LRR_1
Leucine-rich repeat

NLEELNLRNCSSLVELPSSIEKL

FPrintScan: PR00364
IPR000767
711-727 DISEASERSIST
Disease resistance protein

EKLTSLQILDLQGCSSL

HMMPfam: PF00560
IPR001611
715-735 LRR_1
Leucine-rich repeat

SLQILDLQGCSSLVELPSFGN

HMMPfam: PF00560
IPR001611
761-780 LRR_1
Leucine-rich repeat

NLQKLSLRNCSRIVELPAIE

superfamily: SSF52058
811-1010 SSF52058,LRR

LKELNISGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHIKYLRLTGTAIKEVPLSIMSWSPLAEFQISYFESLKEFPHAFDIITELQLSKDIQEVTPWVKRMSRLRYFRLNNCNNLVSLPQLPDSLAYLYADNCKSLEKLDCCFNN

HMMPfam: PF00560
IPR001611
811-830 LRR_1
Leucine-rich repeat

LKELNISGCSSLVKLPSSIG

Gene3D: G3DSA:3.80.10.10
811-1009 G3DSA:3.80.10.10

LKELNISGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHIKYLRLTGTAIKEVPLSIMSWSPLAEFQISYFESLKEFPHAFDIITELQLSKDIQEVTPWVKRMSRLRYFRLNNCNNLVSLPQLPDSLAYLYADNCKSLEKLDCCFN

HMMPfam: PF00560
IPR001611
834-856 LRR_1
Leucine-rich repeat

NLKEFDLSNCSNLVELPSSIGNL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox