PRGDB00049222 (RPM1)

From PRG Wiki
Revision as of 16:46, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4092773 (AF105140)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Brassica napus

Comment?

Brassica napus chromosome N1 disease resistance gene homolog 9N (RPM1) gene, complete cds.

DNA Sequence

ATGGCTTCAGCTACTGTTGATGTTGGGATAGGACTGATTCTCAGCCTCCTAGAAAACGAGACCTTGTTGCTGTCAGGAGTTCACAGCGAGATCGAGAAGATGAAGAAGGAGTTGCTTATCATAAAGTCCTTTCTTGAGGACACACATAAACAAGATTGGAATGGTTCCACCACCACAACAACGGGAACAACAACAACAACTCAACTCTTTCGAACTTTTGTGTCAAACATAAGAGACTTGGCTTACCAAGTGGAAGACATCATCGACGAATTCACCTATCACATCCATGGTTATCGCAGCTGCACAAAGCTTCGGCGTGCGGTTCATTTCCCCAAGTACATGTGGGCTAGGCACTCCATAGCTAAGAAGCTAGGAGCCGTGAATGTCATGATTCGTTCCATTTCTGAATCCATGAAAAGGTACCAAACCTATCAAGGAGCATCAGTATCGCATGTTGATGATGGTGGTGGTACAAAGTGGGTGAATCACATCAGCGAGTCATCTCTGTTCTTTAGTGAAAACAGTCTTGTAGGGATTGATGCAGCTAAAGGAAAGCTCATTGGATGGCTTCTAAGTCCTGAACCTCAAAGGATAGTTGTCTCGGTGGTCGGAATGGGTGGTTCAGGGAAGACTACACTCTCAGCTAACATCTTCAAGTCCCAAACCGTGCGCAAGCATTTCGCGTCATACGCTTGGGTTACTATCTCTAAATCCTATGTGATTGAAGATGTGTTTAGGACAATGATAAAAGAGTTCTACAAAGAAGCAGAAACGCAGATTCCAGGTGAGTTGTACTCCTTAACTTACAGAGAGCTGGTTGAGAAGCTTGTGGAGTATTTGCATTCCAAGAGGTACTTTGTTGTGCTTGATGATGTGTGGAACACTAGTCTGTGGAGGGAGATAAACATCGCTCTACCAGATGGCATTAGCGGAAGCCGTGTTGTGATAACTACTCGCAGCAATAACGTGGCTTCTTTCTCATATGGCAGTGGGAGTAGAAAGCATGAGATTGAGCTCTTGAACGAAGACGAAGCTTGGGTGCTTTTCTGCAACAAAGCGTTTTCTGGAAGCCTTGAGGAATGTAGGAGGAGGAATCTAGAGCTGATAGCAAGGAAGTTACTTGAGAGATGTCAAGGCCTGCCGTTAGCTATAGCTTCTTTGGGGAGCATGATGTCAACAAAGAGGTTGGAGTCAGAGTGGAAGCAAGTCTACAACTCTTTGAACTGGGAACTTAACAACAATCTTGAGCTCAAGGTTGTTAGAAGCATCTTGTCGCTTAGCTTCAGTGATCTGCCGTATCCTCTTAAACGTTGTTTCTTGTACTGTTGTATGTTCCCTGTGAACTATCGGATGAAAAGGAAGAGGCTGGTTAGGATGTGGATGGCGCAACGGTTTGTGGAACCGATCAGAGGAGTGAAAGCGGAGGAAGTGGCTGATGGTTACTTAAATGAGCTTGTTTACAGAAACATGCTTCAAGTTATCTTGTGGAATCCTTTTGGACGTCCCAAAGTGTTCAAGATGCATGATGTGATAAGGGAGATCGCTCTATCTATATCCAAAGCTGAGAGGTTCTGTGATGTTAATGGTGATGATGATGACGATGATGCAGAAACAGCCGAGGATCACGGTACTCGCCATTTATGCATTCAGAAAGAGATGAGATCAGGTACTGTACGTAGAACAAACCTTCACACTCTTTTGGTTTGCACTAAACACAGCATTGAACTGCCTCCAAGTCTGAAACTTCTAAGAGCCTTAGACCTTGAAGGCTCCGGCATCAGCAAGCTACCTGAGATTTTGGTAACTCTGTTCAATTTAAAGTACTTGAACTTGTCGAAAACCGAAGTGAAGGAACTCCCAAGAGACTTTCATAGACTCATCAACTTGGAGACATTGAACACTAGGCACTCCAAGGTTGATGAGCTTCCTCCAGGGATGTGGAAGCTTCGGAAGCTGCGTTATCTGATTACTTTCCGTTGCAACTATGGACATGATTCCAACTGGAACTATGTTTTAGGCACAAAGGTTTCTCCGAGTATCTGCCAGCTGAAGGATTTGCAAGTCATGGACTGCTTCAACGCAGAAGCTGAGCTTATCAAAACGCTAGGGGGCATGACTCAGCTCACGAGAGTAAGTATTGTCATGATTAGAAGAGAACATGGACGTGACTTATGCGAGTCGCTGAACAAGATCAAAAGACTCAGATTCTTATCCCTAACGTCTATTCATGAAGAGGAACCGTTAGAGATAGATAGACTGATAGCAACTGCAAGTATTGAGAAACTCTTTCTTGCAGGGAAACTAGAAAGAGTACCGAGTTGGTTCAGTACTCTTCAGAACGTTACCTATTTGGGTCTGCGCGGCTCTAAGCTGCAAGAAAACTCCATTCACTACCTCCAAACGCTTCCTAAATTAGTATGGCTTTCATTTTATAATGCATACATGGGGACTAGGTTGTGTTTTGCTGAAGGGTTTGAGAATCTGAAGATGCTAGATATAGTCCAGATGAAACATCTGAAAGAGGTTGTGATTGAAGATGGTGCAATGGTTGGGATACAGAAGCTTTACATCAGAGCTTGTAGAGTGTTGGAGTCGGTACCGAGGGGAATAGAGAATCTTGTGAACCTTCAAGAACTGCATTTGAGTCATGTTTCTGATCAGCTAGTGGAGAGGATTCGTGGGGAAGAGGGTGTATACACGTCCAAGGTTAAACATATTCCTGCCATCAAGCATCATTTCAGAACTGAGGATGGCTCTTTCTATGTGAGCCTCTCATCTTGA


Protein sequences

Name Description Sequence
disease resistance gene homolog 9N disease resistance gene homolog 9N [Brassica napus].

MASATVDVGIGLILSLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDWNGSTTTTTGTTTTTQLFRTFVSNIRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPKYMWARHSIAKKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVVLDDVWNTSLWREINIALPDGISGSRVVITTRSNNVASFSYGSGSRKHEIELLNEDEAWVLFCNKAFSGSLEECRRRNLELIARKLLERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILSLSFSDLPYPLKRCFLYCCMFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDAETAEDHGTRHLCIQKEMRSGTVRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKTLGGMTQLTRVSIVMIRREHGRDLCESLNKIKRLRFLSLTSIHEEEPLEIDRLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSKLQENSIHYLQTLPKLVWLSFYNAYMGTRLCFAEGFENLKMLDIVQMKHLKEVVIEDGAMVGIQKLYIRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVYTSKVKHIPAIKHHFRTEDGSFYVSLSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-926 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASATVDVGIGLILSLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDWNGSTTTTTGTTTTTQLFRTFVSNIRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPKYMWARHSIAKKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVVLDDVWNTSLWREINIALPDGISGSRVVITTRSNNVASFSYGSGSRKHEIELLNEDEAWVLFCNKAFSGSLEECRRRNLELIARKLLERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILSLSFSDLPYPLKRCFLYCCMFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDAETAEDHGTRHLCIQKEMRSGTVRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKTLGGMTQLTRVSIVMIRREHGRDLCESLNKIKRLRFLSLTSIHEEEPLEIDRLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSKLQENSIHYLQTLPKLVWLSFYNAYMGTRLCFAEGFENLKMLDIVQMKHLKEVVIEDGAMVGIQKLYIRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVYTSKVKHIPAIKHHFRTEDGSFYVSLSS

HMMPanther: PTHR23155:SF234
2-926 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

ASATVDVGIGLILSLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDWNGSTTTTTGTTTTTQLFRTFVSNIRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPKYMWARHSIAKKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVVLDDVWNTSLWREINIALPDGISGSRVVITTRSNNVASFSYGSGSRKHEIELLNEDEAWVLFCNKAFSGSLEECRRRNLELIARKLLERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILSLSFSDLPYPLKRCFLYCCMFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDAETAEDHGTRHLCIQKEMRSGTVRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKTLGGMTQLTRVSIVMIRREHGRDLCESLNKIKRLRFLSLTSIHEEEPLEIDRLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSKLQENSIHYLQTLPKLVWLSFYNAYMGTRLCFAEGFENLKMLDIVQMKHLKEVVIEDGAMVGIQKLYIRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVYTSKVKHIPAIKHHFRTEDGSFYVSLSS

superfamily: SSF52540
159-415 SSF52540

KWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVVLDDVWNTSLWREINIALPDGISGSRVVITTRSNNVASFSYGSGSRKHEIELLNEDEAWVLFCNKAFSGSLEECRRRNLELIARKLLERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNL

HMMPfam: PF00931
IPR002182
181-469 NB-ARC,NBS
NB-ARC

AAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVVLDDVWNTSLWREINIALPDGISGSRVVITTRSNNVASFSYGSGSRKHEIELLNEDEAWVLFCNKAFSGSLEECRRRNLELIARKLLERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILSLSFSDLPYPLKRCFLYCCMFPVNYRMKRKRLVRMWMAQRFVEPI

Gene3D: G3DSA:3.40.50.300
198-219 G3DSA:3.40.50.300

IVVSVVGMGGSGKTTLSANIFK

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

VVSVVGMGGSGKTTLS

FPrintScan: PR00364
IPR000767
279-293 DISEASERSIST
Disease resistance protein

YLHSKRYFVVLDDVW

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

CQGLPLAIASLGSMM

superfamily: SSF52058
506-883 SSF52058,LRR

KMHDVIREIALSISKAERFCDVNGDDDDDDAETAEDHGTRHLCIQKEMRSGTVRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKTLGGMTQLTRVSIVMIRREHGRDLCESLNKIKRLRFLSLTSIHEEEPLEIDRLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSKLQENSIHYLQTLPKLVWLSFYNAYMGTRLCFAEGFENLKMLDIVQMKHLKEVVIEDGAMVGIQKLYIRACRVLESVPRGIENLVNLQELHLSH

Gene3D: G3DSA:3.80.10.10
560-732 G3DSA:3.80.10.10

RTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKTLGGMTQLTRVSIVMIRREHGRDLCESLNKIK

Gene3D: G3DSA:3.80.10.10
733-883 G3DSA:3.80.10.10

RLRFLSLTSIHEEEPLEIDRLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSKLQENSIHYLQTLPKLVWLSFYNAYMGTRLCFAEGFENLKMLDIVQMKHLKEVVIEDGAMVGIQKLYIRACRVLESVPRGIENLVNLQELHLSH

FPrintScan: PR00364
IPR000767
823-839 DISEASERSIST
Disease resistance protein

EGFENLKMLDIVQMKHL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox