PRGDB00049300 (I2)

From PRG Wiki
Revision as of 16:48, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77641450 (DQ206208)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum clone 1822 I2 (I2) gene, partial cds.

DNA Sequence

ACCTTCAACTTCTTTGATTGATGAATCTCATATCTTTGGTAGGCAGAATGAAATAGAGATTTTGGTTGACTGTTTATTGTCTGTTAATGCCGATGGAAAAACGTATAGTGTAATTCCTATTGTTGGAATGGCGGGGGTTGGCAAGACAACACTTGCTAAAGCTGTGTACAATAACAAGAAGTTGAAAGATCATTTTGATTTGAAAGCTTGGTTCTGTGTGTCGGAACAATATGATGCTTCTAGAATAACAAAAGGATTACTTCAAGAAGTTGGCTCATTTGACTTAAAGGTCGATAACAATCTTAATCAGCTACAAATCAAATTGAAGGAAAGCTTAAAAGGTAAAAAGTTTCTTATTGTTTTAGATGATGTTTGGAATGACAAGTACATGGAGTGGGATGACTTGAGAAATCCTTTTGCACAAGGAGAAATTGAAAGTAAGATCATTGTGAAGACACGTAAGGAGAGTGTTGCAGAGATGATGGGTAGTCGGCCAATTATCATGGAGATTCTTTCTATTGAATTCTCTTGGCCTTTATTCAAAAGTCATGCATTTGAAAATAGGGATCCTAAGGAACATCCGGAACTTGAAGAGGTAGGAAAACAAATTGCAAAAAAGTGCAAGGGTTTACCCTTAGCACTAAAGACACTTGCTGGTTTGTTACGGTCCAAATTAGAGGTTGAGGAGTGGAGACGCATTTTG


Protein sequences

Name Description Sequence
I2 I2 [Nicotiana tabacum].

PSTSLIDESHIFGRQNEIEILVDCLLSVNADGKTYSVIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDVWNDKYMEWDDLRNPFAQGEIESKIIVKTRKESVAEMMGSRPIIMEILSIEFSWPLFKSHAFENRDPKEHPELEEVGKQIAKKCKGLPLALKTLAGLLRSKLEVEEWRRIL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-233 SSF52540

PSTSLIDESHIFGRQNEIEILVDCLLSVNADGKTYSVIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDVWNDKYMEWDDLRNPFAQGEIESKIIVKTRKESVAEMMGSRPIIMEILSIEFSWPLFKSHAFENRDPKEHPELEEVGKQIAKKCKGLPLALKTLAGLLRSKLEVEEWRRI

Gene3D: G3DSA:3.40.50.300
7-124 G3DSA:3.40.50.300

DESHIFGRQNEIEILVDCLLSVNADGKTYSVIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDV

HMMPfam: PF00931
IPR002182
14-234 NB-ARC,NBS
NB-ARC

RQNEIEILVDCLLSVNADGKTYSVIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDVWNDKYMEWDDLRNPFAQGEIESKIIVKTRKESVAEMMGSRPIIMEILSIEFSWPLFKSHAFENRDPKEHPELEEVGKQIAKKCKGLPLALKTLAGLLRSKLEVEEWRRIL

HMMPanther: PTHR11017:SF20
37-234 PTHR11017:SF20,SUBFAMILY NOT NAMED

VIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDVWNDKYMEWDDLRNPFAQGEIESKIIVKTRKESVAEMMGSRPIIMEILSIEFSWPLFKSHAFENRDPKEHPELEEVGKQIAKKCKGLPLALKTLAGLLRSKLEVEEWRRIL

HMMPanther: PTHR11017
37-234 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VIPIVGMAGVGKTTLAKAVYNNKKLKDHFDLKAWFCVSEQYDASRITKGLLQEVGSFDLKVDNNLNQLQIKLKESLKGKKFLIVLDDVWNDKYMEWDDLRNPFAQGEIESKIIVKTRKESVAEMMGSRPIIMEILSIEFSWPLFKSHAFENRDPKEHPELEEVGKQIAKKCKGLPLALKTLAGLLRSKLEVEEWRRIL

FPrintScan: PR00364
IPR000767
37-52 DISEASERSIST
Disease resistance protein

VIPIVGMAGVGKTTLA

FPrintScan: PR00364
IPR000767
111-125 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
207-221 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGLL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox