PRGDB00049577 (disease resistance-like protein)

From PRG Wiki
Revision as of 16:55, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 24459838 (AJ298883)
Gene Class N
Domain Type NBS, Others
Gene Species Coffea canephora

Comment?

Coffea canephora partial ORF for disease resistance-like protein, clone CrgaA1.

DNA Sequence

GGGGGTGGGGAAGACGACTCTTGCTAAATCAGTCTACAACAATCCAAAAATTGATGAGAATTTTGGCATAAAGAGTTGGGTTTGTGTGGCTAGAAAAATTGATACAGTGGGGCTGTTCAAACTCATTTTAGAATCGTTGACAAAAACAAAGGTTGAAGTGGATGGTAGGGAAGCCATAGTTCAAGAAGTTCGAGGAAAGCTCAAGGGACAAAGATATTTCCTTGTTCTTGATGATGTGTGGGACCATGAACAAGGATCGTGGGATGACTATTTCAACACTTTGATGGGACTCAACGAAACCAAAGGAAGCTGGTGTCTTCTCACTACTCGTCTAGAATATGTGGCTAATGCTGTGCCTAGAGATTTGCAAATGAATGATCGTCCTTATTTCTTAGGAAAGCTATCAGGTGATGAGTGCTGGTCCATCATAAAAGGAAAGGTGATGAGTGCAGGGGAAGAAGTACCAGAAGAATTGGAAGCACTGAAGGAGCAAATTTTAAGGAGATGCGATGGCCTCCCCCTCGCCCT


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Coffea canephora].

GVGKTTLAKSVYNNPKIDENFGIKSWVCVARKIDTVGLFKLILESLTKTKVEVDGREAIVQEVRGKLKGQRYFLVLDDVWDHEQGSWDDYFNTLMGLNETKGSWCLLTTRLEYVANAVPRDLQMNDRPYFLGKLSGDECWSIIKGKVMSAGEEVPEELEALKEQILRRCDGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-176 NB-ARC,NBS
NB-ARC

GVGKTTLAKSVYNNPKIDENFGIKSWVCVARKIDTVGLFKLILESLTKTKVEVDGREAIVQEVRGKLKGQRYFLVLDDVWDHEQGSWDDYFNTLMGLNETKGSWCLLTTRLEYVANAVPRDLQMNDRPYFLGKLSGDECWSIIKGKVMSAGEEVPEELEALKEQILRRCDGLPLAL

superfamily: SSF52540
1-176 SSF52540

GVGKTTLAKSVYNNPKIDENFGIKSWVCVARKIDTVGLFKLILESLTKTKVEVDGREAIVQEVRGKLKGQRYFLVLDDVWDHEQGSWDDYFNTLMGLNETKGSWCLLTTRLEYVANAVPRDLQMNDRPYFLGKLSGDECWSIIKGKVMSAGEEVPEELEALKEQILRRCDGLPLAL

FPrintScan: PR00364
IPR000767
66-80 DISEASERSIST
Disease resistance protein

KLKGQRYFLVLDDVW

FPrintScan: PR00364
IPR000767
169-176 DISEASERSIST
Disease resistance protein

CDGLPLAL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox