PRGDB00049623 (serine/threonine kinase-like protein)

From PRG Wiki
Revision as of 16:57, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
serine/threonine kinase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 51318205 (AY663852)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Cucurbita ficifolia

Comment?

Cucurbita ficifolia serine/threonine kinase-like protein gene, partial cds.

DNA Sequence

TTCGGGTCGGTGTACCAGGGCCAGAAGGGGTTTCTTCCACCTGGTGGAGAAGTGGCTATGAAAAGGTTTGAGAGGGCCAATGGAATGGATTGCGTGCGCAATCCTTTCACCACAGAGTTTGAAACAATGCTGGGTTGTTTACGGCACAAGAACTTGGTTTACCTTCAAGGATGGTGCTGTGAAGATACTGAGTTAGTCCTGGTTTCTTATTACTTACCCAATGGAAGCCTCAGCAATATTCTCCACAGAAACTCCAATTCGACGAGAGTCCTGTCATGGAAGCAAAGATTGAATATCGTTTTGGGGGTTGCTTCCGCTCTGACTTATCTGAATGAAGAATGTGAGAGGCAAATAGTTCAAAGAAATGTTCAGACCTGCAATATATTGCTTGATGCGGAGTTCAATGCTAAGCTTGGGGATTTGGGTCTGGCAGAAGTTTATGAACACTGTTCGAATACAAGAGAAGCTACTATACCGGCAGGAACAATGGGATATCTTGCACCTGAGTATCTTTATTCGGGTATTCCCACTGAGAAGACAGACGTCTACAGCTATGGCATA


Protein sequences

Name Description Sequence
serine/threonine kinase-like protein serine/threonine kinase-like protein [Cucurbita ficifolia].

FGSVYQGQKGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-187 Kinase_like
Protein kinase-like domain

FGSVYQGQKGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

Gene3D: G3DSA:3.30.200.20
1-78 G3DSA:3.30.200.20

FGSVYQGQKGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLS

HMMPfam: PF07714
IPR001245
1-187 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FGSVYQGQKGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

ProfileScan: PS50011
IPR000719
1-187 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSVYQGQKGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

HMMPanther: PTHR24420
9-187 PTHR24420,FAMILY NOT NAMED

KGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

HMMPanther: PTHR24420:SF261
9-187 PTHR24420:SF261,LECTIN PROTEIN KINASE FAMILY PROTEIN

KGFLPPGGEVAMKRFERANGMDCVRNPFTTEFETMLGCLRHKNLVYLQGWCCEDTELVLVSYYLPNGSLSNILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI

Gene3D: G3DSA:1.10.510.10
79-187 G3DSA:1.10.510.10

NILHRNSNSTRVLSWKQRLNIVLGVASALTYLNEECERQIVQRNVQTCNILLDAEFNAKLGDLGLAEVYEHCSNTREATIPAGTMGYLAPEYLYSGIPTEKTDVYSYGI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox