PRGDB00049674 (St123)

From PRG Wiki
Revision as of 16:58, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
St123
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 1708713 (U60071)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum disease resistance homolog (St123) gene, partial cds.

DNA Sequence

GGTTTACGACTTCAGTTATGAAACCTCTCCGGCATATCTTGGGTGAGAGGAAGTCACGCAAGATTGCGCTTTTCCTTTTGATCAATACAGCTTACATGGTTGTGGAATTTGCTGCTGGTTTTATGAGTAATAGCCTTGGGTTGATATCAGATGCCTGTCACATGCTGTTTGATTGTGCAGCTCTAGCTATTGGATTATATGCGTCTTACATATCACGGTTGCCAGCAAATGGTCAGTTTAACTACGGCCGTGGAAGATTTGAGGTTCTTTCTGGGTATACAAATGCTGTTCTTTTGGTCCTTGTGGGAGCGTTAATTGTGCTTGAATCATTTGAGAGGATTTTAGACCCTCAGGAGGTTACCACTAACAGTCTATTGTCAGTGTCTGTTGGTGGGCTGCTTGTTAATATTGTGGGTTTGATCTTCTTTCACGAGGAACATCATCATGCCCATGGTGGATCATGTTCCCATTCTCATTCTCATTCCAAAACCCAA


Protein sequences

Name Description Sequence
123.pep 123.pep.

FTTSVMKPLRHILGERKSRKIALFLLINTAYMVVEFAAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLPANGQFNYGRGRFEVLSGYTNAVLLVLVGALIVLESFERILDPQEVTTNSLLSVSVGGLLVNIVGLIFFHEEHHHAHGGSCSHSHSHSKTQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11562
IPR002524
6-153 Cation_efflux
Cation efflux protein

MKPLRHILGERKSRKIALFLLINTAYMVVEFAAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLPANGQFNYGRGRFEVLSGYTNAVLLVLVGALIVLESFERILDPQEVTTNSLLSVSVGGLLVNIVGLIFFHEEHHHAHGGS

Gene3D: G3DSA:1.20.1510.10
15-150 G3DSA:1.20.1510.10

ERKSRKIALFLLINTAYMVVEFAAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLPANGQFNYGRGRFEVLSGYTNAVLLVLVGALIVLESFERILDPQEVTTNSLLSVSVGGLLVNIVGLIFFHEEHHHAH

HMMTigr: TIGR01297
IPR002524
18-147 CDF
Cation efflux protein

SRKIALFLLINTAYMVVEFAAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLPANGQFNYGRGRFEVLSGYTNAVLLVLVGALIVLESFERILDPQEVTTNSLLSVSVGGLLVNIVGLIFFHEEHH

HMMPfam: PF01545
IPR002524
23-153 Cation_efflux
Cation efflux protein

LFLLINTAYMVVEFAAGFMSNSLGLISDACHMLFDCAALAIGLYASYISRLPANGQFNYGRGRFEVLSGYTNAVLLVLVGALIVLESFERILDPQEVTTNSLLSVSVGGLLVNIVGLIFFHEEHHHAHGGS


List of References

D Leister, A Ballvora, F Salamini, C Gebhardt
A PCR-based approach for isolating pathogen resistance genes from potato with potential for wide application in plants.
Nat. Genet.: 1996, 14(4);421-9
PubMed:8944022 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox