PRGDB00049676 (St11)

From PRG Wiki
Revision as of 16:58, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
St11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 1708709 (U60069)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum disease resistance homolog (St11) gene, partial cds.

DNA Sequence

AAAGCGGTTTACAATGATGAGAGGGTGAAGAACCATTTTGGTTTGAAAGCTTGGTTTTGTGTTTCTGAGGCATATGATGCTTTCAGAATAACAAAAGGGTTACTTCAAGAAATTGGCTCATTCGACTTAAAGGTTGTTGACAATCTTCATCAGCTACAATTCAAATTGAAGGAAAGCTTAAAGGGAAAGAAGTTTCTTATTGTTCTGCATGATGTGTGGAATGACAACTACAACCAGTGGTATGACTTGAGAAATGTTTTTGTTCAAGGAGGTTTTGGAAGTAAGATCATTGTGACGACACGTAAAGAGAGTGTTGCCTTGATGATGGGAAATGAGCAAATTAGCATGGACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTCAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAAACAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGTTTTTCCTTTTGTGCAATATTTCCTAAAGATTATCCATTCAGGACAGA


Protein sequences

Name Description Sequence
11.pep 11.pep.

KAVYNDERVKNHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKVVDNLHQLQFKLKESLKGKKFLIVLHDVWNDNYNQWYDLRNVFVQGGFGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRT

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-226 NB-ARC,NBS
NB-ARC

KAVYNDERVKNHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKVVDNLHQLQFKLKESLKGKKFLIVLHDVWNDNYNQWYDLRNVFVQGGFGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFR

HMMPanther: PTHR11017:SF20
1-222 PTHR11017:SF20,SUBFAMILY NOT NAMED

KAVYNDERVKNHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKVVDNLHQLQFKLKESLKGKKFLIVLHDVWNDNYNQWYDLRNVFVQGGFGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKD

superfamily: SSF52540
1-192 SSF52540

KAVYNDERVKNHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKVVDNLHQLQFKLKESLKGKKFLIVLHDVWNDNYNQWYDLRNVFVQGGFGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

HMMPanther: PTHR11017
1-222 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KAVYNDERVKNHFGLKAWFCVSEAYDAFRITKGLLQEIGSFDLKVVDNLHQLQFKLKESLKGKKFLIVLHDVWNDNYNQWYDLRNVFVQGGFGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGKQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKD

FPrintScan: PR00364
IPR000767
59-73 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLHDVW

FPrintScan: PR00364
IPR000767
155-169 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML


List of References

D Leister, A Ballvora, F Salamini, C Gebhardt
A PCR-based approach for isolating pathogen resistance genes from potato with potential for wide application in plants.
Nat. Genet.: 1996, 14(4);421-9
PubMed:8944022 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox