PRGDB00049746 (RGA4)

From PRG Wiki
Revision as of 17:01, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
RGA4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13310464 (AF338968)
Gene Class N
Domain Type NBS, Others
Gene Species Brassica rapa

Comment?

Brassica rapa cultivar R500 disease resistance-like protein (RGA4) gene, partial cds.

DNA Sequence

TACAAAGGAGTTGAATGGAAGAAGAAAAAGGAAAACCAAAAGGCACTAGACATATTCAACTTCTTAAGCAAGAAGAGATTCGTGTTGCTCTTAGATGACATATGGAGGAAAGTAGATTTAACCGAGATTGGTATCCCTAACCCAACAAGCCAAAACGGATGCAAGATAGTATTCACAACTCGCTCTCTAGGCGTATGTACAAGCATGGGTGTCCATGAACCAATGGAGGTACGATGTTTAAGCACAAACGATGCGTGGGACTTGTTCAAGAAGAAAGTTGGACAAAACACACTTGATATACATCCTGACATTCCCAAGATCGCAAGAAAAGTCGCTGGAGCATGCCGTGGCTTGCCTCTAGCGTTGAATGTAATCGGAGAGACAATGTCATGT


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica rapa].

YKGVEWKKKKENQKALDIFNFLSKKRFVLLLDDIWRKVDLTEIGIPNPTSQNGCKIVFTTRSLGVCTSMGVHEPMEVRCLSTNDAWDLFKKKVGQNTLDIHPDIPKIARKVAGACRGLPLALNVIGETMSC

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
5-131 NB-ARC,NBS
NB-ARC

EWKKKKENQKALDIFNFLSKKRFVLLLDDIWRKVDLTEIGIPNPTSQNGCKIVFTTRSLGVCTSMGVHEPMEVRCLSTNDAWDLFKKKVGQNTLDIHPDIPKIARKVAGACRGLPLALNVIGETMSC

superfamily: SSF52540
11-131 SSF52540

ENQKALDIFNFLSKKRFVLLLDDIWRKVDLTEIGIPNPTSQNGCKIVFTTRSLGVCTSMGVHEPMEVRCLSTNDAWDLFKKKVGQNTLDIHPDIPKIARKVAGACRGLPLALNVIGETMSC

FPrintScan: PR00364
IPR000767
21-35 DISEASERSIST
Disease resistance protein

FLSKKRFVLLLDDIW

FPrintScan: PR00364
IPR000767
115-129 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM


List of References

M Fourmann, F Chariot, N Froger, R Delourme, D Brunel
Expression, mapping, and genetic variability of Brassica napus disease resistance gene analogues.
Genome: 2001, 44(6);1083-99
PubMed:11768212 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox