PRGDB00049793 (TRGA-8)

From PRG Wiki
Revision as of 17:02, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
TRGA-8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145572871 (EF093501)
Gene Class NL
Domain Type NBS, LRR
Gene Species Nicotiana debneyi

Comment?

Nicotiana debneyi TRGA-8 gene, partial cds.

DNA Sequence

GAAGGTGCTTGCTTTGTTGCAAATATTAAAGAAAATCAAGCTAAACAAGGATTGCTGTCTCTGCAAAAGACTCTGCTTTCTAAGGTGCTGACCATTGAATCTGTGAATCTTGCTGATGAATATGGTGGAATTGATATAATAAGAAGAAGGCTTGGCTTTAAGAAGGTTCTAGTGGTTCTTGATGATGTGGATCACCAAGACCAGTTGGATGGGCTAGCTGGAGCTCATGATTGGTTTGGTAAATATAGTAGAGTTATTATAACAGCGAGGGACGAGCACTTGCTTTTGAACTGTGATGAC


Protein sequences

Name Description Sequence
TRGA-8 TRGA-8 [Nicotiana debneyi].

EGACFVANIKENQAKQGLLSLQKTLLSKVLTIESVNLADEYGGIDIIRRRLGFKKVLVVLDDVDHQDQLDGLAGAHDWFGKYSRVIITARDEHLLLNCDD


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
3-97 NB-ARC,NBS
NB-ARC

ACFVANIKENQAKQGLLSLQKTLLSKVLTIESVNLADEYGGIDIIRRRLGFKKVLVVLDDVDHQDQLDGLAGAHDWFGKYSRVIITARDEHLLLN

HMMPanther: PTHR11017
4-88 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CFVANIKENQAKQGLLSLQKTLLSKVLTIESVNLADEYGGIDIIRRRLGFKKVLVVLDDVDHQDQLDGLAGAHDWFGKYSRVIIT

HMMPanther: PTHR11017:SF20
4-88 PTHR11017:SF20,SUBFAMILY NOT NAMED

CFVANIKENQAKQGLLSLQKTLLSKVLTIESVNLADEYGGIDIIRRRLGFKKVLVVLDDVDHQDQLDGLAGAHDWFGKYSRVIIT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox