PRGDB00049829 (disease resistance protein-related)

From PRG Wiki
Revision as of 17:04, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
disease resistance protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18415320 (NM_118067)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein-related (AT4G19470) mRNA, complete cds.

DNA Sequence

ATGGATGATACATCCATCAAACAAACTCCCAGAACAATGTGTATGAGTAATCTCAAGCTGTTTTCGTTTGGTGGATCTAAAGTCCAAGATTTCAGAGACATGTATCTCACAGATTGTAATCTGTACAAATTCCCGGACAATTTTAGCTGCTTATCCTCGCTGCAGTCTTTATGCTTGAGCCGAAACAGTATCGAGAATCTACCAGGAAGCATCAAGAAACTTCATCATCTCAAATCTCTTTACTTAAAGAATTGCAAAAATCTCATTTCTCTTCCAGTGCTTCCATCAAATCAGTACTTGGATGTTCATGGCTGTATCTCACTCGAAACAGTTTCAAAACCCATGACGCTTCTAGTGATAGCTGAAAAGACCCATTCTACTTTCGTATTCACGGATTGCTACAAGCTAAACCGAGATGCACAAGAAAAAATTGTGGCTCATACTCAGCTCAAGAGTCAAATACTGGCGAATAGATCTTTTCAACTTAATCATAAGGTCCAATCTCTGGAACTAGTTTTGGAACCTTTATCTGCTGTAAGTTTTCCAGGGAATGATTTGCCACTATGGTTCCGCCATCAGAGAATTGGATCTTCAATGGAAACCAACCTGCCTTCACACTGGTGCGACGATAAATTCATTGGTCTTTCTCTCTGCACGGTTGTCTCTTTCAAGGACTATGAAGATAGAACCAGCCGGTTCTCCGTGATATGCAAGTGCAAGTTCAGAAACGAAGACGGTGATTACATCAGCTTTACATGTAATCTTGGGGGATGGAAAGAGCAGTGTGGATCGTCTAGCCATGAAGAATCAAGAAGACTTAGCTCTGATCATGTGTTCATCAGTTATAGCAACTGTTACCATGCCAAGAAAAACGATGATCTCAATAGATGTTGCAACACCACAGCCTCGTTCAAATTTTTTGTTACTGATGGCAGAGCCAAAAGAAAACTAGATTGCTGTGAGGTGGTGAAATGCGGGATGAGCTTGTTATATGCACCAGATGAGAATGATTGTAGGTTGCATGGGTTACACGAGAATAATCTTGAGAAAGAGATATCTGGAAAAGATACAGAACTAAACGAAACCGCCTTGGATAAAGTTGTTGTGTCCAAGAGAGGCCGTTTATGTGTACAAGAAGAAGAGCTACTGAACAGGAAAAGAATAAAGGAAGACGTCTCTTTTGGTAATTACGATTGTTCTGTAACTTCTATTCTTAGTTACATGGAGCCAGCAAAGCCTCATCTCTGGAAATAA


Protein sequences

Name Description Sequence
disease resistance protein-related disease resistance protein-related [Arabidopsis thaliana].

MDDTSIKQTPRTMCMSNLKLFSFGGSKVQDFRDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVLPSNQYLDVHGCISLETVSKPMTLLVIAEKTHSTFVFTDCYKLNRDAQEKIVAHTQLKSQILANRSFQLNHKVQSLELVLEPLSAVSFPGNDLPLWFRHQRIGSSMETNLPSHWCDDKFIGLSLCTVVSFKDYEDRTSRFSVICKCKFRNEDGDYISFTCNLGGWKEQCGSSSHEESRRLSSDHVFISYSNCYHAKKNDDLNRCCNTTASFKFFVTDGRAKRKLDCCEVVKCGMSLLYAPDENDCRLHGLHENNLEKEISGKDTELNETALDKVVVSKRGRLCVQEEELLNRKRIKEDVSFGNYDCSVTSILSYMEPAKPHLWK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF48
1-151 PTHR23155:SF48,SUBFAMILY NOT NAMED

MDDTSIKQTPRTMCMSNLKLFSFGGSKVQDFRDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVLPSNQYLDVHGCISLETVSKPMTLLVIAEKTHSTFVFTDCYKLNRDAQEKIVAHTQLK

superfamily: SSF52058
1-112 SSF52058,LRR

MDDTSIKQTPRTMCMSNLKLFSFGGSKVQDFRDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVLPSNQYLDVHGCISLETVS

HMMPanther: PTHR23155
1-151 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDDTSIKQTPRTMCMSNLKLFSFGGSKVQDFRDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVLPSNQYLDVHGCISLETVSKPMTLLVIAEKTHSTFVFTDCYKLNRDAQEKIVAHTQLK

Gene3D: G3DSA:3.80.10.10
5-104 G3DSA:3.80.10.10

SIKQTPRTMCMSNLKLFSFGGSKVQDFRDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVLPSNQYLDVHG

ProfileScan: PS51450
IPR001611
53-74 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLCLSRNSIENLPGSIKKL

HMMPfam: PF12799
53-94 LRR_4,Leucine Rich repeats (2 copies)

SLQSLCLSRNSIENLPGSIKKLHHLKSLYLKNCKNLISLPVL

ProfileScan: PS51450
IPR001611
76-98 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLKSLYLKNCKNLISLPVLPSNQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox