PRGDB00049931 (Os10g0473900)

From PRG Wiki
Revision as of 17:08, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Os10g0473900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115482481 (NM_001071369)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os10g0473900 (Os10g0473900) mRNA, complete cds.

DNA Sequence

ATGGCCGTGGTGCTCGGCGCGTTCGTGCCGGACACCGCGGCGCAGTGGCGCAGCGTGGTGAAGGGGGAGGTGGCGCGGCAGCTGGGCGTGGAGGCGGAGGCGAGGAAGCTGGGGGCGAGGCTGGAGAAGGTGGGCGCCGCGGTGCGCGACGCCGAGGCGCGGGTGGCGCGCGGGAGCGACGCCGCGGCGCGGTGGCTCGCCAGGGTGCGCGCCGCGGCGTACGAGGCCGACGTCGCCGTCGACCGGTGCAGGGCCACGGCGCGCCGCCTGACGAGGGGCCGGGAGCAGCAGCTGCAGCAGCATAACCAGGCACTGCCATGGCTGCTGTCCACCTGCTGCGACGTGGCCGAGCCGCGCCGCGACATCGCCGCCGACCTCAAGAACGTCAGCCAGAAGCTCAAGTCCATCATCAAGGAGCAGCGGCAGCTGCAGCTCCAGGCATCCGTCGCCGATCACACTGACGACCATCCACGGAAGATCCTGAGGCACCGGAAATCCGAACCCACCGACATCGACATCGTCGGCACGGCAATGGAGGACGACGCGCGCCGCCTCGTGCGCCGGCTGACGCAGCCAGACAGCGGCGGCGTCGTGGCCATCTACGGCCCCGACGGCATTGGCAAGACCACACTGGCGAAGGTGGTGTTCGACAGCGAGAGGGTGAAGCGAAGATTCGAGACGAGGTCATGGGTTCACGTCTCCAGGGGTTGCGTCGAGGACGGCAAGCGAGAGGCCGCGCTGCTCTCGCAGGTCGTCGAGGCCGTCGTTGACGGCGGCGGCGCCACGACGGGCGCCGAGACCGTCGCCGAGCTGGAGAGAATGCTGGCCGCCCTGGTGGCGAACAGGAGGTTCTTGCTCGTGCTCGACGAGGTGAGGAACGGCGGCGAGTGGGAGGAGTTGGTGAGGCGGCTACTCGAGCGCGGCGGCCGCGGCAGCAAGGTGCTGGTCACCGCGGTCACCGCCGGCGTCGCTCGGGACATGGGCGCCGGCCACGTCCACCGCGTGAACAGGCTCGGCGAGGACGACGGCTGGGCGCTGCTCCGCGTGGCGGCGTGCGTCGCCGACGACGGCGGCGCGGCGCTGAGGGGCGTCGGCCGGAGGATCGTCGGCAAGTGCGGCGGCGTCCCTCTGGCGATCAGGGCGGTCGCCGGCGTTCTGAGGACGCGGGAGGCGATCGCCGAGGAGTGGGCGGTGGTGGACGCGAGCCCGGCGTGGAAGGTGAAGGGGCTCCCCGACGACGCCATGAAGCCGCTGTACCTCTGTTACGACGACATGCCGTGCCACCTGAAGCAGTGCTTCCTCTACTGCTCGCTGTTCCTCTCGGACTTCGCCGTCGACAGGAGATCGCTGGTGCAGCAGTGGATCGCCGAGGGCTTCGTGCAGATCAGGGGAGACGCCGGCGTCGAGGAGGTGGCCGAGGAGTACTACGACGAGCTCATCGGAAGGAACCTCCTCCAGCCGGCGGAGGCCGACCGGCACGGCTGCGTCGAGCGGTGCACGATGCACGACACGCTGCGGTCCATGGCGCAGGTGCTCTCCCATGGCGAGAACCTCACCGGCGATGCGCAGGCGCAGCGGCTGCCCAGCGACGGCGACGCCCCCTTCGCGCCACGGCACGTCTCGTTTCCGAGGAACCACCTTGCTGCAATACCAGAGGAGGTTCTGAAGCTTGAGGGTGTAAGAACGCTGCTGCTCCAGAGAAATCCACTGACAATTGGGAGCAACATCTTTACAAGGCTGCTATACCTGAAAGTCTTGGACCTTACTGAAACTGCAATGGAGGTCATTCCAGAGACTTTGGGGAATCTGTTATACCTGAGGTTCTTGAACCTGTCCCAGACAAGGATCAAGGCGCTTCCAGAAACCATTTGCAATCTGTGGAGCCTCAAATTCTTGCTGCTAAGAGAGTGCAAGGCATTGCATGTGTTGCCAAAAGGGATAGAGCATCTGAAGGGGCTCAGAGACCTTGATCTTACAGGTACTGTGATCAAAGACGCGGCATTCAGAGTAGGCCATCTCAGAAACCTCACATCATTCCGATGCTTCACCGTGACGAGCAAAGAGGCGCGTACCGTACAGGATACCGCACAGGATAGGAGTGGGTGGCCTCTGGATGAGCTCAAGAACTTGTGTCAGCTAAGGACACTCCATGTTAAGAGGCTTGAGAAGGCCACTAGTCAGTCCAAGGCAGCTGAAGTAGCTCTTCATGCCAAGACAGGACTCAGAGAGCTTGAACTGTCGTGCAGCGGCACCGTCAAGACATTACAGATACCGACAGTGGTCCGAAATATAGAGGATATCTTCCAAGAGCTGAAACCGCCACGAGGCCTCGAGTCGCTGAAGATTGCAAACTACTTTGGGACAAAGTTCCCGACATGGCTGTCATCGACCTGCCTGCCAAATCTCCTCCGACTGAATATAACCGGATGCAATTTCTGCCAATCTTTTCCTCTATTAGGTCGTCTGCCAGAGTTGAGATCTTTGTGCATTGCCGATTCTTCAGCGCTGAAGGATATCGATGCTCAGCTTATGGACACAGACAACTCCCATCAGGTACCATTTCCAAAGCTGGAAGACCTGCACCTGCAAGGTTTGCATAATCTGGAGACGTGGACGAGCATTGAGGCAGGGGCGTTGCCATCTCTGCAGGCTCTGCAGCTTGAAAGCTGCCCCAAGCTGAGATGCTTACCAGATGGCCTCAGGCATGTGACATCCATGACTGAGCTGCGCATTGTGGACATGGAGAGCCTTGAGGCTGTTGAGAACATTGCTGCACTGAGGGAACTGAGTGTTTGGAACACCCCCAATCTGAAGAAAATATGCAACTTGCCTTCCCTCGAAGATCTTGACATATGCCATTGTCCGTCGCTGGAGACTGTGGACAACATCAACAGGCTGCAAGAGGTGCACATCTTCGATCATGAATTGCAGGAGATGCCGAGATGGATCCAGGCACATGCATCGAAGCTCTGCTCACTGGAATTCATGAGCACAACTGAACTGTTGAAGAGGTGCTTGATTGATGGTCCTGACTGGCCCGTGATCAAGGACATTGCACAAGTTCATGGATACTCGAATGACTCTAGTTACATATACTATTCCAAGAGTCTCAAGATCTTTGAGGGCAGCGCGAGTATTCGAGAAAGCCGTGATGCAGAAAGGAGTGTGGCAGATTCTGATAAAGTTGACGATGCATCAATAGAGAGCAGAAACGTTGATCGAGATGCAGAAATCGATGGCTTCTTCAGCTCAAAATTAGTGGAGACAGGAACTGCCAGGAGTGAAGACAATGTACCGGATAGGAATATGGAGAGGTTCATGACAAGATCCACTGGCCGCCGATTGCATAAGCTGGAAGAAGTCCCCGAAGGAGATGAGGATGAGGAAGAGGAAGGTGCAGATCCAGTAGTTCTGATTCCTGATGATACAACTAAATCTGACACCGTACTGGAGAAACTTCATCCTGTTGTTACTCATGATCATAATGATAAAGCGGGATCCAAGATGAAAAGGGATCCTCCTGCAAAAACTGCTCCAGGTACTTCTGTTATTCAATCTGCTGCCACAATGTGTCATAAGTTGGTCCGAGAAGGGTCTCAAGCAATCAGCATTACTGAAACTGATCAAGATCTGAGCCTCGATTCATTTCGAAGCAAAGAACATGCATCTAGTAAGCAGAAAGTTGACACATCTGGTTCTGTCATAGAAAAAGTAAAGGAAGGAAGATATAAATCTGCAAATATCAATGACCGTAAGCACATTGAGAGAGTTCATGACTCTGCAAATAAGATGTCAACTACTTCTGTGGAGAAAAGCATTCCCGAAACAGTCAAACCTATGAAAGCAACAAAGAATAATTCTAAAGCAACAGACTATCATGGAACTGAGAATAAGTCACCTGATAGTTTGGCTTGTTCCAGGCAAACAATAAGCCAGATAGAAAAGGATGTTTCTGATGCTGATAAGGCTGCAAATCATCCATCCAGCGCGATCACAGAGAATCGTCTACACAAAGCAAATGAGATCGATGCTTCTGCTACTGCAATAAAAACTGAAGTATCAAAGAAATCTGCTGGTGCCAATATTTGTAATACCTTAAACCCTGCAGATTCACAAACAGTACATGCTACTGACACTGCTCAAGATTTGCCTTCCAGTTTACTCCATGATGACCCACATTTACCAGATGTTGGCAGCAGTACTTCTACTTCTATCAGTGACAATTGCATTCAGACAGAGAGCAGCAACACAAGTTTGTCGGCCAACTTAAATAATGAAGAACCTAAAGCGAAAGGTGTTACCAAAACTACTTGCGCATCAGGGCCTTGCAAACTGACTGCCACCTTAGACTGCAAACAACAGACTACTAATCCAAGTGACGACACAGATGCATCCATGAAGAAGATGGCGAGCAACATCTCTGAGAAAGTTGTCAAAACATTGAAACGCCCACATGCTGAAACAGTGAATATTACTCGCTCTTCATCACTGCCAATTGACCCTAAATCTCATGTCATTGATACCACTGCAGCAACGAAGAAACTAGAAGCTACCCTGAAAAACAGATCCTCAAGAAATGCAGCACCTGGCCTTGCCGATGACAAAACCCCAGTATACAACGACTCCCATCAGGCACCAAAGGTGTATACCGCCATCTGGGCCGACACCGACACGGACACCCTGAAAGCCCGGTTCCTCAGCACGATGCAGCACTACCGCAGGATGGCTTCGCACCGTCGCCGACGCCATAGAAAGCATGGCTCCAGGACCAAGTGGAGCATCTGGCCAGTGCTGGTGGCCATCCTCCTGATCATCTCAGTGGCACAGCTGCTGTTCACCTTCTGGATGTACCGCAAGCTCATGAATCAAAACTCAAAAGTAGGGAAAGAAGCTACCTCGAATTCAGATTGTCCCCAATTTTTTTCCCCATCCTTTTCGCTTCTTACATTTGCCCTTGAATCCTTCAGCGTTGTCGATGAGGAAGTGAAGCCGATCTCGCCGCCGCCGGAGAAGGAGGAGGAGGAGGCCATCTCGCCGCCGCAACCGCCGAAGCGGGAGATCATCCGAGTCACCACCAAGGCGATCGTCAAGGAGAAGGCGAGCGCATTCTCGTCGGTGGGCTCCTCCTCCTCCTCGGGGAAGAGCGGCGCCGGCGGCGGCGCCCTCAACGCGGCGGCGCTGTTCAGGCGGTTCAACAGCTCAGCCCCCGTGCCGAGAGCGGAGGCCGCGGGAGACGGCGATGGCGGCGTCCGGCTGGAGATCGAGGACATCGCGGCGGGGGATCGCCGCCGCGAGACCAGGAAGCGGAAGAGCCCCCTCGACGCGAGCGGCGGCGGGTGGTGGCACGGCGAGATGGAGGGCGTCGACGGCGAGGAGGTGGGGTGGACCGACGACATGTGGGAGGGGATGGGGTCCATCACGCTCGGAGGCTTGGAGTGGCACTAG


Protein sequences

Name Description Sequence
hypothetical protein Os10g0473900 [Oryza sativa (japonica cultivar-group)].

MAVVLGAFVPDTAAQWRSVVKGEVARQLGVEAEARKLGARLEKVGAAVRDAEARVARGSDAAARWLARVRAAAYEADVAVDRCRATARRLTRGREQQLQQHNQALPWLLSTCCDVAEPRRDIAADLKNVSQKLKSIIKEQRQLQLQASVADHTDDHPRKILRHRKSEPTDIDIVGTAMEDDARRLVRRLTQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVTAGVARDMGAGHVHRVNRLGEDDGWALLRVAACVADDGGAALRGVGRRIVGKCGGVPLAIRAVAGVLRTREAIAEEWAVVDASPAWKVKGLPDDAMKPLYLCYDDMPCHLKQCFLYCSLFLSDFAVDRRSLVQQWIAEGFVQIRGDAGVEEVAEEYYDELIGRNLLQPAEADRHGCVERCTMHDTLRSMAQVLSHGENLTGDAQAQRLPSDGDAPFAPRHVSFPRNHLAAIPEEVLKLEGVRTLLLQRNPLTIGSNIFTRLLYLKVLDLTETAMEVIPETLGNLLYLRFLNLSQTRIKALPETICNLWSLKFLLLRECKALHVLPKGIEHLKGLRDLDLTGTVIKDAAFRVGHLRNLTSFRCFTVTSKEARTVQDTAQDRSGWPLDELKNLCQLRTLHVKRLEKATSQSKAAEVALHAKTGLRELELSCSGTVKTLQIPTVVRNIEDIFQELKPPRGLESLKIANYFGTKFPTWLSSTCLPNLLRLNITGCNFCQSFPLLGRLPELRSLCIADSSALKDIDAQLMDTDNSHQVPFPKLEDLHLQGLHNLETWTSIEAGALPSLQALQLESCPKLRCLPDGLRHVTSMTELRIVDMESLEAVENIAALRELSVWNTPNLKKICNLPSLEDLDICHCPSLETVDNINRLQEVHIFDHELQEMPRWIQAHASKLCSLEFMSTTELLKRCLIDGPDWPVIKDIAQVHGYSNDSSYIYYSKSLKIFEGSASIRESRDAERSVADSDKVDDASIESRNVDRDAEIDGFFSSKLVETGTARSEDNVPDRNMERFMTRSTGRRLHKLEEVPEGDEDEEEEGADPVVLIPDDTTKSDTVLEKLHPVVTHDHNDKAGSKMKRDPPAKTAPGTSVIQSAATMCHKLVREGSQAISITETDQDLSLDSFRSKEHASSKQKVDTSGSVIEKVKEGRYKSANINDRKHIERVHDSANKMSTTSVEKSIPETVKPMKATKNNSKATDYHGTENKSPDSLACSRQTISQIEKDVSDADKAANHPSSAITENRLHKANEIDASATAIKTEVSKKSAGANICNTLNPADSQTVHATDTAQDLPSSLLHDDPHLPDVGSSTSTSISDNCIQTESSNTSLSANLNNEEPKAKGVTKTTCASGPCKLTATLDCKQQTTNPSDDTDASMKKMASNISEKVVKTLKRPHAETVNITRSSSLPIDPKSHVIDTTAATKKLEATLKNRSSRNAAPGLADDKTPVYNDSHQAPKVYTAIWADTDTDTLKARFLSTMQHYRRMASHRRRRHRKHGSRTKWSIWPVLVAILLIISVAQLLFTFWMYRKLMNQNSKVGKEATSNSDCPQFFSPSFSLLTFALESFSVVDEEVKPISPPPEKEEEEAISPPQPPKREIIRVTTKAIVKEKASAFSSVGSSSSSGKSGAGGGALNAAALFRRFNSSAPVPRAEAAGDGDGGVRLEIEDIAAGDRRRETRKRKSPLDASGGGWWHGEMEGVDGEEVGWTDDMWEGMGSITLGGLEWH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF193
5-958 OS10G0473900 PROTEIN,OS10G0473900 PROTEIN

LGAFVPDTAAQWRSVVKGEVARQLGVEAEARKLGARLEKVGAAVRDAEARVARGSDAAARWLARVRAAAYEADVAVDRCRATARRLTRGREQQLQQHNQALPWLLSTCCDVAEPRRDIAADLKNVSQKLKSIIKEQRQLQLQASVADHTDDHPRKILRHRKSEPTDIDIVGTAMEDDARRLVRRLTQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVTAGVARDMGAGHVHRVNRLGEDDGWALLRVAACVADDGGAALRGVGRRIVGKCGGVPLAIRAVAGVLRTREAIAEEWAVVDASPAWKVKGLPDDAMKPLYLCYDDMPCHLKQCFLYCSLFLSDFAVDRRSLVQQWIAEGFVQIRGDAGVEEVAEEYYDELIGRNLLQPAEADRHGCVERCTMHDTLRSMAQVLSHGENLTGDAQAQRLPSDGDAPFAPRHVSFPRNHLAAIPEEVLKLEGVRTLLLQRNPLTIGSNIFTRLLYLKVLDLTETAMEVIPETLGNLLYLRFLNLSQTRIKALPETICNLWSLKFLLLRECKALHVLPKGIEHLKGLRDLDLTGTVIKDAAFRVGHLRNLTSFRCFTVTSKEARTVQDTAQDRSGWPLDELKNLCQLRTLHVKRLEKATSQSKAAEVALHAKTGLRELELSCSGTVKTLQIPTVVRNIEDIFQELKPPRGLESLKIANYFGTKFPTWLSSTCLPNLLRLNITGCNFCQSFPLLGRLPELRSLCIADSSALKDIDAQLMDTDNSHQVPFPKLEDLHLQGLHNLETWTSIEAGALPSLQALQLESCPKLRCLPDGLRHVTSMTELRIVDMESLEAVENIAALRELSVWNTPNLKKICNLPSLEDLDICHCPSLE

HMMPanther: PTHR23155
5-958 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LGAFVPDTAAQWRSVVKGEVARQLGVEAEARKLGARLEKVGAAVRDAEARVARGSDAAARWLARVRAAAYEADVAVDRCRATARRLTRGREQQLQQHNQALPWLLSTCCDVAEPRRDIAADLKNVSQKLKSIIKEQRQLQLQASVADHTDDHPRKILRHRKSEPTDIDIVGTAMEDDARRLVRRLTQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVTAGVARDMGAGHVHRVNRLGEDDGWALLRVAACVADDGGAALRGVGRRIVGKCGGVPLAIRAVAGVLRTREAIAEEWAVVDASPAWKVKGLPDDAMKPLYLCYDDMPCHLKQCFLYCSLFLSDFAVDRRSLVQQWIAEGFVQIRGDAGVEEVAEEYYDELIGRNLLQPAEADRHGCVERCTMHDTLRSMAQVLSHGENLTGDAQAQRLPSDGDAPFAPRHVSFPRNHLAAIPEEVLKLEGVRTLLLQRNPLTIGSNIFTRLLYLKVLDLTETAMEVIPETLGNLLYLRFLNLSQTRIKALPETICNLWSLKFLLLRECKALHVLPKGIEHLKGLRDLDLTGTVIKDAAFRVGHLRNLTSFRCFTVTSKEARTVQDTAQDRSGWPLDELKNLCQLRTLHVKRLEKATSQSKAAEVALHAKTGLRELELSCSGTVKTLQIPTVVRNIEDIFQELKPPRGLESLKIANYFGTKFPTWLSSTCLPNLLRLNITGCNFCQSFPLLGRLPELRSLCIADSSALKDIDAQLMDTDNSHQVPFPKLEDLHLQGLHNLETWTSIEAGALPSLQALQLESCPKLRCLPDGLRHVTSMTELRIVDMESLEAVENIAALRELSVWNTPNLKKICNLPSLEDLDICHCPSLE

Seg: seg
44-57 seg

VGAAVRDAEARVAR

Seg: seg
61-73 seg

AAARWLARVRAAA

Coil: coil
126-147 coiled-coil

LKNVSQKLKSIIKEQRQLQLQA

superfamily: SSF52540
154-409 P-loop containing nucleoside triphosphate hydrolases

DDHPRKILRHRKSEPTDIDIVGTAMEDDARRLVRRLTQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVTAGVARDMGAGHVHRVNRLGEDDGWALLRVAACVADDGGAALRGVGRRIVGKCGGVPLAIRAVAGVLRTREAIAEEWAVVDASPAWKVKG

HMMPfam: PF00931
IPR002182
179-462 NB-ARC,NBS
NB-ARC

EDDARRLVRRLTQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVTAGVARDMGAGHVHRVNRLGEDDGWALLRVAACVADDGGAALRGVGRRIVGKCGGVPLAIRAVAGVLRTREAIAEEWAVVDASPAWKVKGLPDDAMKPLYLCYDDMPCHLKQCFLYCSLFLSDFAVDRRSLVQQWIAEGFVQI

Gene3D: G3DSA:3.40.50.300
190-320 no description

TQPDSGGVVAIYGPDGIGKTTLAKVVFDSERVKRRFETRSWVHVSRGCVEDGKREAALLSQVVEAVVDGGGATTGAETVAELERMLAALVANRRFLLVLDEVRNGGEWEELVRRLLERGGRGSKVLVTAVT

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

VVAIYGPDGIGKTTLA

Seg: seg
251-270 seg

VVEAVVDGGGATTGAETVAE

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

LVANRRFLLVLDEVR

Seg: seg
294-311 seg

GGEWEELVRRLLERGGRG

Seg: seg
349-360 seg

VAACVADDGGAA

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGGVPLAIRAVAGVL

superfamily: SSF52058
500-1000 L domain-like,LRR

TMHDTLRSMAQVLSHGENLTGDAQAQRLPSDGDAPFAPRHVSFPRNHLAAIPEEVLKLEGVRTLLLQRNPLTIGSNIFTRLLYLKVLDLTETAMEVIPETLGNLLYLRFLNLSQTRIKALPETICNLWSLKFLLLRECKALHVLPKGIEHLKGLRDLDLTGTVIKDAAFRVGHLRNLTSFRCFTVTSKEARTVQDTAQDRSGWPLDELKNLCQLRTLHVKRLEKATSQSKAAEVALHAKTGLRELELSCSGTVKTLQIPTVVRNIEDIFQELKPPRGLESLKIANYFGTKFPTWLSSTCLPNLLRLNITGCNFCQSFPLLGRLPELRSLCIADSSALKDIDAQLMDTDNSHQVPFPKLEDLHLQGLHNLETWTSIEAGALPSLQALQLESCPKLRCLPDGLRHVTSMTELRIVDMESLEAVENIAALRELSVWNTPNLKKICNLPSLEDLDICHCPSLETVDNINRLQEVHIFDHELQEMPRWIQAHASKLCSLEFMSTTE

Gene3D: G3DSA:3.80.10.10
538-721 no description

RHVSFPRNHLAAIPEEVLKLEGVRTLLLQRNPLTIGSNIFTRLLYLKVLDLTETAMEVIPETLGNLLYLRFLNLSQTRIKALPETICNLWSLKFLLLRECKALHVLPKGIEHLKGLRDLDLTGTVIKDAAFRVGHLRNLTSFRCFTVTSKEARTVQDTAQDRSGWPLDELKNLCQLRTLHVKRL

Seg: seg
600-611 seg

LGNLLYLRFLNL

Gene3D: G3DSA:3.80.10.10
788-963 no description

TKFPTWLSSTCLPNLLRLNITGCNFCQSFPLLGRLPELRSLCIADSSALKDIDAQLMDTDNSHQVPFPKLEDLHLQGLHNLETWTSIEAGALPSLQALQLESCPKLRCLPDGLRHVTSMTELRIVDMESLEAVENIAALRELSVWNTPNLKKICNLPSLEDLDICHCPSLETVDNI

FPrintScan: PR00364
IPR000767
941-957 DISEASERSIST
Disease resistance protein

CNLPSLEDLDICHCPSL

Seg: seg
1028-1039 seg

SSYIYYSKSLKI

Seg: seg
1055-1066 seg

SVADSDKVDDAS

Seg: seg
1119-1137 seg

EEVPEGDEDEEEEGADPVV

Seg: seg
1412-1427 seg

TESSNTSLSANLNNEE

Seg: seg
1508-1520 seg

TTAATKKLEATLK

Seg: seg
1571-1589 seg

HYRRMASHRRRRHRKHGSR

Seg: seg
1660-1680 seg

EEVKPISPPPEKEEEEAISPP

Seg: seg
1700-1726 seg

ASAFSSVGSSSSSGKSGAGGGALNAAA

Seg: seg
1783-1794 seg

GEMEGVDGEEVG


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox