PRGDB00049945 (Os09g0357400)

From PRG Wiki
Revision as of 17:08, 7 August 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Os09g0357400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115478754 (NM_001069506)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os09g0357400 (Os09g0357400) mRNA, complete cds.

DNA Sequence

ATGACCAGTGTCAGGCCGGTCACAAATCGGTCATTCTTGTCCACCACGCGTCAGTTTATCAATCTGCATGTTCGCCCTTCTTCATACAATGTCTTGCTTGTAACGGTTGGGATGAAGCCTGGCATATATCTGACCGGGACCAACGTGCCATCTCCAGGAGCTAGCACGCTGGCTCCGGCTAGGGACAAGTGCCTGGAGGCTCTTATCCTGACGGGATGGGGCGAGGCCGCTCCTGATATTAAGAAAGTTTTCAAGGACATGCTGCTTGAGCTCGACAAGACAAAGAACAAGGACATCCATAACCTAGTCAGGGATGAGAAGCAGCTCATTGATGAGCTCAGAGATTTCATTCAGAACAAGAGATTTCCACACGCACGTAGGTACATAATTGTAATTGATGACATATGGGATATAGCATCATGGAGTGCAATTAGATGTGCTTTGGTGGAAAACAATGATGGGAGCACAATAATTGCAACTACCCGTGATTTCGATATTGCGGAACAAATAGGTAGTCCTCATAAACTAAAAACCCTTCCACCCAAGAGCTCTAAAAAATTATTCTACGGGAGAATATTTGGCTCCGAGGACAAATGTCCACAAGAGTTAGTTGAAGTATCTGGAAAGATATTGAAGAAATGCAGCGATGTACCATTAGCTATCATAACTATAGCTATTGTGTTGGCTAGAACTAGAAACATGGCAGAAGAGTGGTACAAGGTGTATAATTCAATTGGCTATGGACTTGGAAACAACCATGATATGAAAAACATGAGAAAGATACTGTCACTTAGCTATCACAATTTACCTTCCCACCTAAGGACCTGCTTACTTTATCTGAGTATATTTCCCGAAGATTATGAAATTGAAAGATCTCGATTAATAAGGATGTGGATATCTGAAGGTTTCATCCATCCAGAAAAGGATGGGGACAACTTGTTCGAGTTAGCAGATAGTTACTTTAATGAGCTTATAAATCGAAGCCTCATCCAACCATCAGGTTATGTTAGTGGTATGCTACATTCTTGTCGTGTGCATGATATGATTCATGATCTTATCCGATCCTTGTCATCTAAAGAGAACTTTGTTACTGTAATGGATGGCATTTTGCAACAGACATCTCCAGCAAGCAAGGTTCGTAGGCTCTCTCTCCAGAATAACAAGCTAGAGAACAGCACAGCTCAGACCAACCTGAAGATGTCACAAGTGAGGTCGCTTTCTATATTCAGTAGTTCTGGTGTTAGTTTATTACCATCTCTTTCAAGCTTCCAGGTTCTACGTGTGCTGGATCTAGAAAATTGTTATCTTACAGAAGGTTGCCATCTTGATCTTAGGCATGTTTGTAACTTATTTCACCTAAGGTACTTAAGACTCTACGAATGTAACTTTGACCGTGAGCTTCTCAAGGAGATAGAGAAGCTGAGTTTTTGCAGACGTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os09g0357400 [Oryza sativa (japonica cultivar-group)].

MTSVRPVTNRSFLSTTRQFINLHVRPSSYNVLLVTVGMKPGIYLTGTNVPSPGASTLAPARDKCLEALILTGWGEAAPDIKKVFKDMLLELDKTKNKDIHNLVRDEKQLIDELRDFIQNKRFPHARRYIIVIDDIWDIASWSAIRCALVENNDGSTIIATTRDFDIAEQIGSPHKLKTLPPKSSKKLFYGRIFGSEDKCPQELVEVSGKILKKCSDVPLAIITIAIVLARTRNMAEEWYKVYNSIGYGLGNNHDMKNMRKILSLSYHNLPSHLRTCLLYLSIFPEDYEIERSRLIRMWISEGFIHPEKDGDNLFELADSYFNELINRSLIQPSGYVSGMLHSCRVHDMIHDLIRSLSSKENFVTVMDGILQQTSPASKVRRLSLQNNKLENSTAQTNLKMSQVRSLSIFSSSGVSLLPSLSSFQVLRVLDLENCYLTEGCHLDLRHVCNLFHLRYLRLYECNFDRELLKEIEKLSFCRR


Domains

Domain Start-End Description Sequence

HMMPfam: PF06882
IPR010685
1-77 DUF1263
Domain of unknown function DUF1263

MTSVRPVTNRSFLSTTRQFINLHVRPSSYNVLLVTVGMKPGIYLTGTNVPSPGASTLAPARDKCLEALILTGWGEAA

superfamily: SSF52540
77-253 P-loop containing nucleoside triphosphate hydrolases

APDIKKVFKDMLLELDKTKNKDIHNLVRDEKQLIDELRDFIQNKRFPHARRYIIVIDDIWDIASWSAIRCALVENNDGSTIIATTRDFDIAEQIGSPHKLKTLPPKSSKKLFYGRIFGSEDKCPQELVEVSGKILKKCSDVPLAIITIAIVLARTRNMAEEWYKVYNSIGYGLGNNH

HMMPfam: PF00931
IPR002182
80-308 NB-ARC,NBS
NB-ARC

IKKVFKDMLLELDKTKNKDIHNLVRDEKQLIDELRDFIQNKRFPHARRYIIVIDDIWDIASWSAIRCALVENNDGSTIIATTRDFDIAEQIGSPHKLKTLPPKSSKKLFYGRIFGSEDKCPQELVEVSGKILKKCSDVPLAIITIAIVLARTRNMAEEWYKVYNSIGYGLGNNHDMKNMRKILSLSYHNLPSHLRTCLLYLSIFPEDYEIERSRLIRMWISEGFIHPEK

HMMPanther: PTHR11017
85-433 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KDMLLELDKTKNKDIHNLVRDEKQLIDELRDFIQNKRFPHARRYIIVIDDIWDIASWSAIRCALVENNDGSTIIATTRDFDIAEQIGSPHKLKTLPPKSSKKLFYGRIFGSEDKCPQELVEVSGKILKKCSDVPLAIITIAIVLARTRNMAEEWYKVYNSIGYGLGNNHDMKNMRKILSLSYHNLPSHLRTCLLYLSIFPEDYEIERSRLIRMWISEGFIHPEKDGDNLFELADSYFNELINRSLIQPSGYVSGMLHSCRVHDMIHDLIRSLSSKENFVTVMDGILQQTSPASKVRRLSLQNNKLENSTAQTNLKMSQVRSLSIFSSSGVSLLPSLSSFQVLRVLDLEN

HMMPanther: PTHR11017:SF126
85-433 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

KDMLLELDKTKNKDIHNLVRDEKQLIDELRDFIQNKRFPHARRYIIVIDDIWDIASWSAIRCALVENNDGSTIIATTRDFDIAEQIGSPHKLKTLPPKSSKKLFYGRIFGSEDKCPQELVEVSGKILKKCSDVPLAIITIAIVLARTRNMAEEWYKVYNSIGYGLGNNHDMKNMRKILSLSYHNLPSHLRTCLLYLSIFPEDYEIERSRLIRMWISEGFIHPEKDGDNLFELADSYFNELINRSLIQPSGYVSGMLHSCRVHDMIHDLIRSLSSKENFVTVMDGILQQTSPASKVRRLSLQNNKLENSTAQTNLKMSQVRSLSIFSSSGVSLLPSLSSFQVLRVLDLEN

Seg: seg
172-187 seg

SPHKLKTLPPKSSKKL

superfamily: SSF52058
344-475 L domain-like,LRR

RVHDMIHDLIRSLSSKENFVTVMDGILQQTSPASKVRRLSLQNNKLENSTAQTNLKMSQVRSLSIFSSSGVSLLPSLSSFQVLRVLDLENCYLTEGCHLDLRHVCNLFHLRYLRLYECNFDRELLKEIEKLS

Gene3D: G3DSA:3.80.10.10
359-475 no description

KENFVTVMDGILQQTSPASKVRRLSLQNNKLENSTAQTNLKMSQVRSLSIFSSSGVSLLPSLSSFQVLRVLDLENCYLTEGCHLDLRHVCNLFHLRYLRLYECNFDRELLKEIEKLS

Seg: seg
405-422 seg

SLSIFSSSGVSLLPSLSS


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox